BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30324 (709 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0346 - 17776871-17781445 33 0.29 12_02_0343 - 17748882-17753396 33 0.29 >12_02_0346 - 17776871-17781445 Length = 1524 Score = 32.7 bits (71), Expect = 0.29 Identities = 20/65 (30%), Positives = 30/65 (46%) Frame = -1 Query: 658 NKFAIKIGDSHDEQYVLHKILVSLCI*VEVLLTRAINQSTYAIQNTCRFSKCIFHENFLH 479 N F ++G HD YV+H +L L + R +N ST + N K I H + + Sbjct: 556 NGFFEQVGKEHDSPYVMHDLLHELATNISSHEIRCLNSSTLSSIN--EIPKSIRHMSIIV 613 Query: 478 NYVHV 464 + HV Sbjct: 614 DNRHV 618 >12_02_0343 - 17748882-17753396 Length = 1504 Score = 32.7 bits (71), Expect = 0.29 Identities = 20/65 (30%), Positives = 30/65 (46%) Frame = -1 Query: 658 NKFAIKIGDSHDEQYVLHKILVSLCI*VEVLLTRAINQSTYAIQNTCRFSKCIFHENFLH 479 N F ++G HD YV+H +L L + R +N ST + N K I H + + Sbjct: 557 NGFFEQVGKEHDSPYVMHDLLHELATNISSHEIRCLNSSTLSSIN--EIPKSIRHMSIIV 614 Query: 478 NYVHV 464 + HV Sbjct: 615 DNRHV 619 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,224,347 Number of Sequences: 37544 Number of extensions: 213920 Number of successful extensions: 342 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 337 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 342 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1827423340 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -