BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30323 (674 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical prote... 25 2.9 AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical prote... 25 2.9 DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domai... 24 5.0 AJ297933-1|CAC35453.2| 392|Anopheles gambiae Ag9 protein protein. 23 6.7 AF510719-1|AAP47148.1| 591|Anopheles gambiae ammonium transport... 23 8.8 >AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 24.6 bits (51), Expect = 2.9 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -2 Query: 106 RTHLNIVPPGAAGSKACTTNDRVYIIRLEHLG 11 RT + P G + + +TN +VY LEH G Sbjct: 294 RTKRDFHPTGCSLNNLLSTNRKVYEFGLEHEG 325 >AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 24.6 bits (51), Expect = 2.9 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -2 Query: 106 RTHLNIVPPGAAGSKACTTNDRVYIIRLEHLG 11 RT + P G + + +TN +VY LEH G Sbjct: 294 RTKRDFHPTGCSLNNLLSTNRKVYEFGLEHEG 325 >DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domain protein protein. Length = 285 Score = 23.8 bits (49), Expect = 5.0 Identities = 14/38 (36%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -3 Query: 576 SSSAPCKSK-PLVLGSK*RYFLCGKLRVLQICGWFPQV 466 SS P K P+ G+K CG+ LQ CG Q+ Sbjct: 188 SSVRPSKGLIPVAPGAKCPITTCGRNEALQACGTCNQI 225 >AJ297933-1|CAC35453.2| 392|Anopheles gambiae Ag9 protein protein. Length = 392 Score = 23.4 bits (48), Expect = 6.7 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +1 Query: 364 LYCTDTVRHWRSPPWTRVHNETLR 435 +Y D + RSPP R+ N T+R Sbjct: 42 MYLRDWRKALRSPPSYRIGNRTIR 65 >AF510719-1|AAP47148.1| 591|Anopheles gambiae ammonium transport-like protein protein. Length = 591 Score = 23.0 bits (47), Expect = 8.8 Identities = 5/10 (50%), Positives = 8/10 (80%) Frame = -1 Query: 668 VPSRWAWGQH 639 +P+ W WG+H Sbjct: 174 IPAGWVWGEH 183 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 817,205 Number of Sequences: 2352 Number of extensions: 19226 Number of successful extensions: 52 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 51 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 52 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 67741110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -