BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30321 (761 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 22 5.4 DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholi... 22 7.1 AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex det... 21 9.4 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 22.2 bits (45), Expect = 5.4 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -2 Query: 94 VPMVRAATSDKPISPQNS 41 +PM ++ TSD P S QNS Sbjct: 220 LPMWKSDTSDGPESHQNS 237 >DQ026038-1|AAY87897.1| 520|Apis mellifera nicotinic acetylcholine receptor beta1subunit protein. Length = 520 Score = 21.8 bits (44), Expect = 7.1 Identities = 10/38 (26%), Positives = 20/38 (52%), Gaps = 2/38 (5%) Frame = -3 Query: 669 KYLIVSRFSS--SKILAGAFVDWFLAEGRAHRFPRILR 562 KYL+ + + S ++ ++W R HR P+++R Sbjct: 298 KYLLFTFIMNTVSILVTVIIINWNFRGPRTHRMPQLIR 335 >AY569720-1|AAS86673.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.4 bits (43), Expect = 9.4 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -1 Query: 149 AGLANHTISNNSYLQSL 99 + L+N+TI NN+Y + L Sbjct: 316 SSLSNNTIHNNNYNKKL 332 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 215,543 Number of Sequences: 438 Number of extensions: 4709 Number of successful extensions: 12 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 23789892 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -