BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30320 (750 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 23 3.1 Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 p... 23 4.0 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 22 5.3 DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization prot... 21 9.3 >DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine receptor beta2subunit protein. Length = 427 Score = 23.0 bits (47), Expect = 3.1 Identities = 7/17 (41%), Positives = 13/17 (76%) Frame = +1 Query: 580 WTAFVCSVITFIDLLIV 630 W+AF+C + +I +LI+ Sbjct: 399 WSAFLCISLVYIIMLII 415 >Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 protein. Length = 402 Score = 22.6 bits (46), Expect = 4.0 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +1 Query: 310 KYGRKVANIISVLPVIVGWLL 372 +YGR V I+V + V WLL Sbjct: 132 RYGRWVTRRIAVAGIAVVWLL 152 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 22.2 bits (45), Expect = 5.3 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = +1 Query: 592 VCSVITFIDLLIVINSPESPSWLADQGKYED 684 VC T+ L + + +P + L+++ KYED Sbjct: 576 VCDNQTYTSLQMAMKNPIEFTDLSNERKYED 606 >DQ666693-1|ABG29167.1| 250|Apis mellifera MAX dimerization protein protein. Length = 250 Score = 21.4 bits (43), Expect = 9.3 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 67 KKQKTKENSNSAE*HREFELN 5 K+ KTK++ S H E E N Sbjct: 39 KRPKTKKSQGSRTTHNELEKN 59 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 217,387 Number of Sequences: 438 Number of extensions: 5132 Number of successful extensions: 9 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23510295 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -