BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30315 (748 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1718.01 |pop1|ste16, SPBC2G2.18|F-box/WD repeat protein Pop1... 27 2.8 SPAP27G11.14c |||sequence orphan|Schizosaccharomyces pombe|chr 1... 26 5.0 SPBC14F5.02 |||sequence orphan|Schizosaccharomyces pombe|chr 2||... 26 6.6 >SPBC1718.01 |pop1|ste16, SPBC2G2.18|F-box/WD repeat protein Pop1|Schizosaccharomyces pombe|chr 2|||Manual Length = 775 Score = 27.1 bits (57), Expect = 2.8 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = +2 Query: 464 SNHKYRSPSSSNPSLATKSSASELTHRYSPLSFSPDLLGGS 586 SN + + +PS+ SS R+SP S DLL G+ Sbjct: 14 SNEFFGETTMVSPSIDVSSSPRPNVERFSPCSTKKDLLEGN 54 >SPAP27G11.14c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 689 Score = 26.2 bits (55), Expect = 5.0 Identities = 17/55 (30%), Positives = 28/55 (50%) Frame = +3 Query: 105 SVVKLMPNPCAAR*DNSTSTPQNEIRSRRKIRRYAPVQADNTAVIPQICKLLFFF 269 +V KL C R DN S N R +++RY+ ++++P++ LL FF Sbjct: 604 AVQKLGGLQCIIRNDN-LSHIFNCSRKYIRVQRYSDDDLSESSLLPRLVNLLLFF 657 >SPBC14F5.02 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 515 Score = 25.8 bits (54), Expect = 6.6 Identities = 15/31 (48%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +2 Query: 488 SSSNPS-LATKSSASELTHRYSPLSFSPDLL 577 S+S+PS + + SS S + Y+PL FS DLL Sbjct: 382 SASSPSYVPSGSSFSVRANLYNPLDFSIDLL 412 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,903,245 Number of Sequences: 5004 Number of extensions: 58389 Number of successful extensions: 163 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 160 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 163 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 355273338 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -