BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30315 (748 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. 23 2.3 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 23 4.0 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 23 4.0 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 7.0 DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 21 9.3 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 21 9.3 >DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. Length = 471 Score = 23.4 bits (48), Expect = 2.3 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -2 Query: 423 GFIMTCLGRRGQSRLSRPKILKTLYVLVLTV 331 GF+MT L R GQS + +L + V V + Sbjct: 67 GFLMTFLRRYGQSAVGLTFLLGAILVQVAII 97 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 22.6 bits (46), Expect = 4.0 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = +2 Query: 410 VIMNPPDPXXXXXXXXXFSNHKYRSPSSSNPS 505 + +PP P F N YR SSSNPS Sbjct: 1025 ITWSPPLPELRHGDIQGF-NVGYRETSSSNPS 1055 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 22.6 bits (46), Expect = 4.0 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = +2 Query: 410 VIMNPPDPXXXXXXXXXFSNHKYRSPSSSNPS 505 + +PP P F N YR SSSNPS Sbjct: 1021 ITWSPPLPELRHGDIQGF-NVGYRETSSSNPS 1051 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.8 bits (44), Expect = 7.0 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -2 Query: 444 STVNGSGGFIMTCLGRRGQ 388 ST+ GSGG + L +RGQ Sbjct: 728 STLEGSGGDSLRTLLQRGQ 746 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.4 bits (43), Expect = 9.3 Identities = 19/69 (27%), Positives = 27/69 (39%) Frame = +2 Query: 497 NPSLATKSSASELTHRYSPLSFSPDLLGGSCFRSGERFCKARLLLGLVSATLPV*AP*AH 676 +PS S R+ + S + L S G RF + L+ G LP+ Sbjct: 393 HPSTQEDSEEHLTPKRFHSRAASKEDLSPSSLADGARFGGSCLIHGPPLPPLPLHTECED 452 Query: 677 LHVKGDAEI 703 L V G+A I Sbjct: 453 LSVSGEAGI 461 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.4 bits (43), Expect = 9.3 Identities = 19/69 (27%), Positives = 27/69 (39%) Frame = +2 Query: 497 NPSLATKSSASELTHRYSPLSFSPDLLGGSCFRSGERFCKARLLLGLVSATLPV*AP*AH 676 +PS S R+ + S + L S G RF + L+ G LP+ Sbjct: 393 HPSTQEDSEEHLTPKRFHSRAASKEDLSPSSLADGARFGGSCLIHGPPLPPLPLHTECED 452 Query: 677 LHVKGDAEI 703 L V G+A I Sbjct: 453 LSVSGEAGI 461 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 194,260 Number of Sequences: 438 Number of extensions: 4185 Number of successful extensions: 14 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23388480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -