BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30313 (547 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 ... 21 5.3 AY600514-1|AAT11862.1| 242|Tribolium castaneum iroquois-like pr... 21 7.0 >AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 463 Score = 21.4 bits (43), Expect = 5.3 Identities = 10/39 (25%), Positives = 16/39 (41%) Frame = +2 Query: 173 WPYFWLGTVLHGIYADNFWHFVLPEXDNFWHSQTPIIFL 289 WP+ + I AD + F ++H TP + L Sbjct: 2 WPFVVQKKHITEIIADIYRQFPTDRYVGYYHFMTPTLLL 40 >AY600514-1|AAT11862.1| 242|Tribolium castaneum iroquois-like protein protein. Length = 242 Score = 21.0 bits (42), Expect = 7.0 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = -3 Query: 233 NARSYLRKSHEVRYRAKNK 177 NAR L+K +++ + KNK Sbjct: 137 NARRRLKKENKMTWEPKNK 155 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 121,529 Number of Sequences: 336 Number of extensions: 2451 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 13411456 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -