BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30313 (547 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0295 + 17006064-17007063,17007068-17007666 28 4.2 01_06_1256 - 35775149-35775590,35775782-35775840 28 4.2 12_02_0291 + 16951154-16952740 27 7.4 >12_02_0295 + 17006064-17007063,17007068-17007666 Length = 532 Score = 28.3 bits (60), Expect = 4.2 Identities = 10/44 (22%), Positives = 24/44 (54%) Frame = +2 Query: 26 SMETWLDWXVRKNDXKQLWAAQPTYIISQAVYVLAGLLTLXHAF 157 S+ETW+ + LW+ P ++ +A Y+++ L+ + ++ Sbjct: 3 SVETWVGFGSAMAGVGLLWSRMPEHVHEEARYIISSLVPMAMSY 46 >01_06_1256 - 35775149-35775590,35775782-35775840 Length = 166 Score = 28.3 bits (60), Expect = 4.2 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = -3 Query: 407 PSPPRKAPRNVEDSALRLHT 348 P PP++ +N ED AL LHT Sbjct: 8 PFPPKRKRQNGEDGALHLHT 27 >12_02_0291 + 16951154-16952740 Length = 528 Score = 27.5 bits (58), Expect = 7.4 Identities = 10/40 (25%), Positives = 22/40 (55%) Frame = +2 Query: 26 SMETWLDWXVRKNDXKQLWAAQPTYIISQAVYVLAGLLTL 145 S+ETW+ + LW+ P ++ +A Y+++ L+ + Sbjct: 3 SVETWVGFGSALAGVGLLWSRMPEHVHDEARYIISSLVPM 42 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,523,675 Number of Sequences: 37544 Number of extensions: 254396 Number of successful extensions: 530 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 524 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 530 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1222086348 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -