BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30313 (547 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 23 5.0 AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase ... 23 8.7 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 23.4 bits (48), Expect = 5.0 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 1/46 (2%) Frame = +1 Query: 7 WRLLVA-EYGNVVGLXRPKK*HXAIVGCPTYIYNISGRLRFGWPFN 141 WR+ +YGN++ P G YIY+ SG LRF +N Sbjct: 1923 WRVSYEYDYGNLIDKRTPDG------GTYEYIYSESGILRFSIHYN 1962 >AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase protein. Length = 849 Score = 22.6 bits (46), Expect = 8.7 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -1 Query: 298 PGSQEYDRGLRMPEIIVLWQYEMPEVICVNPMK 200 PGS +YD + + +WQ ++I +N K Sbjct: 501 PGSTDYDTEIYPIGLDPVWQLASNKIIFLNSYK 533 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 532,993 Number of Sequences: 2352 Number of extensions: 9700 Number of successful extensions: 5 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 50460840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -