BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30313 (547 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U43318-1|AAC50385.1| 585|Homo sapiens transmembrane receptor pr... 29 8.0 >U43318-1|AAC50385.1| 585|Homo sapiens transmembrane receptor protein. Length = 585 Score = 29.5 bits (63), Expect = 8.0 Identities = 26/97 (26%), Positives = 41/97 (42%), Gaps = 3/97 (3%) Frame = +2 Query: 182 FWLG--TVLHGIYADNFWHFVLPEXDNFWHSQTPIIFLGA-RLPLHIILLYPAXIYHAXY 352 FW+G +VL I L + D F + + PIIFL A L + + L + HA Sbjct: 237 FWIGLWSVLCFISTSTTVATFLIDMDTFRYPERPIIFLSACYLCVSLGFLVRLVVGHASV 296 Query: 353 AVSKLNLPRYAEPFAVGLXTVLIDIPYDIXAVKFVHW 463 A S+ + + E L T++ + Y + W Sbjct: 297 ACSREHNHIHYETTGPALCTIVFLLVYFFGMASSIWW 333 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 76,769,369 Number of Sequences: 237096 Number of extensions: 1532255 Number of successful extensions: 3031 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2951 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3031 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 5364536570 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -