BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30312 (750 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY390608-1|AAR27305.1| 242|Anopheles gambiae SP22D protein. 27 0.82 AY390607-1|AAR27304.1| 242|Anopheles gambiae SP22D protein. 27 0.82 AY390606-1|AAR27303.1| 241|Anopheles gambiae SP22D protein. 27 0.82 AY390605-1|AAR27302.1| 241|Anopheles gambiae SP22D protein. 27 0.82 AY390604-1|AAR27301.1| 241|Anopheles gambiae SP22D protein. 27 0.82 AY390603-1|AAR27300.1| 241|Anopheles gambiae SP22D protein. 27 0.82 AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 27 0.82 AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22... 27 0.82 DQ383732-1|ABD47743.1| 201|Anopheles gambiae IAP-antagonist mic... 25 2.5 AM085517-1|CAJ30215.1| 339|Anopheles gambiae putative angiotens... 24 5.8 AJ459962-1|CAD31061.1| 685|Anopheles gambiae prophenoloxidase 9... 23 7.6 >AY390608-1|AAR27305.1| 242|Anopheles gambiae SP22D protein. Length = 242 Score = 26.6 bits (56), Expect = 0.82 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +3 Query: 351 ANVCRKPLHQLFTQFAGLEAEDDGSGDVKY 440 A + R+P+H L F GLE + +G Y Sbjct: 93 AKLIRQPVHTLLKDFNGLECPEGRTGHFPY 122 >AY390607-1|AAR27304.1| 242|Anopheles gambiae SP22D protein. Length = 242 Score = 26.6 bits (56), Expect = 0.82 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +3 Query: 351 ANVCRKPLHQLFTQFAGLEAEDDGSGDVKY 440 A + R+P+H L F GLE + +G Y Sbjct: 93 AKLIRQPVHTLLKDFNGLECPEGRTGHFPY 122 >AY390606-1|AAR27303.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 26.6 bits (56), Expect = 0.82 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +3 Query: 351 ANVCRKPLHQLFTQFAGLEAEDDGSGDVKY 440 A + R+P+H L F GLE + +G Y Sbjct: 92 AKLIRQPVHTLLKDFNGLECPEGRTGHFPY 121 >AY390605-1|AAR27302.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 26.6 bits (56), Expect = 0.82 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +3 Query: 351 ANVCRKPLHQLFTQFAGLEAEDDGSGDVKY 440 A + R+P+H L F GLE + +G Y Sbjct: 92 AKLIRQPVHTLLKDFNGLECPEGRTGHFPY 121 >AY390604-1|AAR27301.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 26.6 bits (56), Expect = 0.82 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +3 Query: 351 ANVCRKPLHQLFTQFAGLEAEDDGSGDVKY 440 A + R+P+H L F GLE + +G Y Sbjct: 92 AKLIRQPVHTLLKDFNGLECPEGRTGHFPY 121 >AY390603-1|AAR27300.1| 241|Anopheles gambiae SP22D protein. Length = 241 Score = 26.6 bits (56), Expect = 0.82 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +3 Query: 351 ANVCRKPLHQLFTQFAGLEAEDDGSGDVKY 440 A + R+P+H L F GLE + +G Y Sbjct: 92 AKLIRQPVHTLLKDFNGLECPEGRTGHFPY 121 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 26.6 bits (56), Expect = 0.82 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +3 Query: 351 ANVCRKPLHQLFTQFAGLEAEDDGSGDVKY 440 A + R+P+H L F GLE + +G Y Sbjct: 164 AKLIRQPVHTLLKDFNGLECPEGRTGHFPY 193 >AF117751-1|AAD38337.3| 1322|Anopheles gambiae serine protease 22D protein. Length = 1322 Score = 26.6 bits (56), Expect = 0.82 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +3 Query: 351 ANVCRKPLHQLFTQFAGLEAEDDGSGDVKY 440 A + R+P+H L F GLE + +G Y Sbjct: 163 AKLIRQPVHTLLKDFNGLECPEGRTGHFPY 192 >DQ383732-1|ABD47743.1| 201|Anopheles gambiae IAP-antagonist michelob_x protein. Length = 201 Score = 25.0 bits (52), Expect = 2.5 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = -3 Query: 682 AGPTGASSRNTTP*PANAASPCSRIDITFLPSL 584 AGP A+ TP P A+ P S T +PS+ Sbjct: 70 AGPNAATVTAATPQPPAASMPPSTTTNTQIPSM 102 >AM085517-1|CAJ30215.1| 339|Anopheles gambiae putative angiotensin converting enzymeprecursor protein. Length = 339 Score = 23.8 bits (49), Expect = 5.8 Identities = 9/34 (26%), Positives = 19/34 (55%) Frame = +3 Query: 648 VVFRDDAPVGPARLHHARDHTHXRQQPDRVHDPT 749 +++RD P P+R + R+ + +P +DP+ Sbjct: 179 LLYRDRTPYNPSRDYDDRNRYNPNARPYNPNDPS 212 >AJ459962-1|CAD31061.1| 685|Anopheles gambiae prophenoloxidase 9 protein. Length = 685 Score = 23.4 bits (48), Expect = 7.6 Identities = 8/24 (33%), Positives = 13/24 (54%) Frame = -2 Query: 293 FRGNVDDLLHRRNQNFAPFQTETL 222 F G+VDD+ Q +P++ L Sbjct: 404 FHGHVDDVFDMHKQKLSPYKAHEL 427 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 800,530 Number of Sequences: 2352 Number of extensions: 16812 Number of successful extensions: 114 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 113 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 114 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 77339358 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -