BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30309 (761 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_01_0610 + 4889158-4889386,4889584-4890297,4890814-4891166,489... 29 3.1 07_03_0235 - 15564620-15564748,15565037-15565083,15565305-155653... 28 9.3 >11_01_0610 + 4889158-4889386,4889584-4890297,4890814-4891166, 4891619-4891830,4892633-4892889,4892984-4893162, 4893901-4893948 Length = 663 Score = 29.5 bits (63), Expect = 3.1 Identities = 14/48 (29%), Positives = 21/48 (43%) Frame = -3 Query: 687 NLMFPKRSEGGSLVVNNYRPMFDPIVFKWFTIDDRYLRRTERVFRHLY 544 N + P GS +V + PM + WF DR+ R + F + Y Sbjct: 583 NKLLPSYVPEGSFIVREHTPMSNLFSCLWFNEVDRFTPRDQLSFAYTY 630 >07_03_0235 - 15564620-15564748,15565037-15565083,15565305-15565374, 15566228-15566303,15567063-15567132,15567541-15567637, 15568257-15568319 Length = 183 Score = 27.9 bits (59), Expect = 9.3 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = -3 Query: 108 YYLTFTYFIYSHKSTSSTPLIVDCNISCTAFA 13 +YL+F++ Y + TS++ L + NIS +A Sbjct: 60 FYLSFSWLYYEYHETSNSFLAISKNISSLLYA 91 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,510,016 Number of Sequences: 37544 Number of extensions: 360319 Number of successful extensions: 667 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 655 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 667 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2039640244 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -