BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30309 (761 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ010193-1|CAA09032.1| 684|Anopheles gambiae prophenoloxidase p... 29 0.16 AJ459960-1|CAD31059.1| 696|Anopheles gambiae prophenoloxidase 7... 24 4.5 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 23 7.8 >AJ010193-1|CAA09032.1| 684|Anopheles gambiae prophenoloxidase protein. Length = 684 Score = 29.1 bits (62), Expect = 0.16 Identities = 13/36 (36%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = -3 Query: 663 EGGSLVVNNYRPMFDPIVFKWFT-IDDRYLRRTERV 559 EG +V +N M DP+ ++W IDD ++R +R+ Sbjct: 384 EGFGVVGDNTTAMRDPVFYRWHQHIDDIFVRHKQRL 419 >AJ459960-1|CAD31059.1| 696|Anopheles gambiae prophenoloxidase 7 protein. Length = 696 Score = 24.2 bits (50), Expect = 4.5 Identities = 10/34 (29%), Positives = 18/34 (52%) Frame = -3 Query: 627 MFDPIVFKWFTIDDRYLRRTERVFRHLYCATIKN 526 M DP+ ++W T D +R ++ F A ++N Sbjct: 409 MRDPVFYRWHTFVDSIFQRHKQRFAPYGPAELRN 442 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 23.4 bits (48), Expect = 7.8 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -3 Query: 630 PMFDPIVFKWFTIDDRY 580 P FD + KW T DR+ Sbjct: 131 PSFDGEITKWLTFKDRF 147 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 747,667 Number of Sequences: 2352 Number of extensions: 14468 Number of successful extensions: 36 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 36 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79002570 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -