BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30307 (721 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC12G12.09 |||sequence orphan|Schizosaccharomyces pombe|chr 1|... 27 2.0 SPBC3E7.15c |mug83|SPBC4F6.02c|sphingosine N-acyltransferase Lac... 26 6.2 SPCC550.11 |||karyopherin|Schizosaccharomyces pombe|chr 3|||Manual 26 6.2 SPBC660.17c |||sequence orphan|Schizosaccharomyces pombe|chr 2||... 26 6.2 SPAC4A8.05c |myp2|myo3|myosin II heavy chain |Schizosaccharomyce... 26 6.2 SPBC582.03 |cdc13||cyclin Cdc13|Schizosaccharomyces pombe|chr 2|... 25 8.2 SPBP23A10.12 |||FRG1 family protein|Schizosaccharomyces pombe|ch... 25 8.2 >SPAC12G12.09 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 977 Score = 27.5 bits (58), Expect = 2.0 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Frame = -2 Query: 657 LWELG-LETRFWSNGKRPLIESYFERVRQRESFKNTIPNLPQHLKMI 520 L E+G LET F +N L +Y RQ F N I N+ Q L+ + Sbjct: 758 LLEVGFLETGFLANDLENLTSTYRSSNRQLCDFSNRIGNINQKLEKL 804 >SPBC3E7.15c |mug83|SPBC4F6.02c|sphingosine N-acyltransferase Lac1|Schizosaccharomyces pombe|chr 2|||Manual Length = 384 Score = 25.8 bits (54), Expect = 6.2 Identities = 7/20 (35%), Positives = 15/20 (75%), Gaps = 1/20 (5%) Frame = +1 Query: 502 WRWSRNY-HFKVLWQIWNSI 558 W + R+Y +FK++W +W ++ Sbjct: 287 WIYMRHYLNFKIMWAVWGTM 306 >SPCC550.11 |||karyopherin|Schizosaccharomyces pombe|chr 3|||Manual Length = 1029 Score = 25.8 bits (54), Expect = 6.2 Identities = 10/23 (43%), Positives = 17/23 (73%) Frame = -1 Query: 670 PLATSLGIRIRNTFLE*RKETLD 602 P A+ L ++RNTF++ +ET+D Sbjct: 582 PFASQLAKQLRNTFVKLMQETMD 604 >SPBC660.17c |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 172 Score = 25.8 bits (54), Expect = 6.2 Identities = 10/38 (26%), Positives = 21/38 (55%) Frame = -3 Query: 290 YVIFYISKLIFTLKSKNPKGFKILFMVGSGLTVPLALL 177 YV++++ + K P +K LF++ G+T + +L Sbjct: 84 YVMYFLPLEVGLFNPKTPNKWKFLFILNIGVTALITVL 121 >SPAC4A8.05c |myp2|myo3|myosin II heavy chain |Schizosaccharomyces pombe|chr 1|||Manual Length = 2104 Score = 25.8 bits (54), Expect = 6.2 Identities = 10/31 (32%), Positives = 20/31 (64%) Frame = +2 Query: 326 SVNFDNNQSYSIFIAISKANKNHNMNLNSDK 418 ++ FDNN+ +S+F+ I+ N+ + SD+ Sbjct: 335 TLGFDNNEIHSLFLIIASILHIGNIEVASDR 365 >SPBC582.03 |cdc13||cyclin Cdc13|Schizosaccharomyces pombe|chr 2|||Manual Length = 482 Score = 25.4 bits (53), Expect = 8.2 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -2 Query: 579 RQRESFKNTIPNLPQHL 529 RQ F +++P+LPQHL Sbjct: 115 RQPSVFNSSVPSLPQHL 131 >SPBP23A10.12 |||FRG1 family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 245 Score = 25.4 bits (53), Expect = 8.2 Identities = 13/44 (29%), Positives = 23/44 (52%) Frame = -2 Query: 696 SIADINLAVLLQRLWELGLETRFWSNGKRPLIESYFERVRQRES 565 +IA ++ V+ + W + ++TRF K L ++ RQ ES Sbjct: 162 AIACVSDTVIPEAKWRIRVQTRFLKKNKSSLFDNPTIHSRQLES 205 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,475,012 Number of Sequences: 5004 Number of extensions: 47982 Number of successful extensions: 124 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 124 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 124 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 337208592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -