BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30307 (721 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_02_0772 - 23029703-23029715,23029835-23030463,23030637-230316... 28 8.6 07_01_0828 - 6679393-6680432,6680448-6680784 28 8.6 >12_02_0772 - 23029703-23029715,23029835-23030463,23030637-23031673, 23031830-23032166 Length = 671 Score = 27.9 bits (59), Expect = 8.6 Identities = 15/47 (31%), Positives = 24/47 (51%), Gaps = 3/47 (6%) Frame = -2 Query: 663 QRLWELGLETRFWSNGKRPLIESYFER---VRQRESFKNTIPNLPQH 532 Q L ++ E W+ +R +ESY E + + E+ KN I N Q+ Sbjct: 344 QNLGKILSEEEQWAENERLFLESYEEEINLINEMENIKNEIDNAEQY 390 >07_01_0828 - 6679393-6680432,6680448-6680784 Length = 458 Score = 27.9 bits (59), Expect = 8.6 Identities = 15/47 (31%), Positives = 24/47 (51%), Gaps = 3/47 (6%) Frame = -2 Query: 663 QRLWELGLETRFWSNGKRPLIESYFER---VRQRESFKNTIPNLPQH 532 Q L ++ E W+ +R +ESY E + + E+ KN I N Q+ Sbjct: 391 QNLGKILSEEEQWAENERLFLESYEEEINLINEMENIKNEIDNAEQY 437 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,544,420 Number of Sequences: 37544 Number of extensions: 255426 Number of successful extensions: 619 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 612 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 619 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1874582652 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -