BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30307 (721 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY071643-1|AAL49265.1| 327|Drosophila melanogaster RE69232p pro... 69 5e-12 AE014296-931|AAF50802.1| 327|Drosophila melanogaster CG4623-PA ... 69 5e-12 >AY071643-1|AAL49265.1| 327|Drosophila melanogaster RE69232p protein. Length = 327 Score = 69.3 bits (162), Expect = 5e-12 Identities = 30/58 (51%), Positives = 41/58 (70%) Frame = -2 Query: 717 WLCCENFSIADINLAVLLQRLWELGLETRFWSNGKRPLIESYFERVRQRESFKNTIPN 544 WL + S+ADI+L +LL RL++LG E +FW+ GK P +E+YF R RQRESF P+ Sbjct: 234 WLTGDELSVADISLGLLLHRLYQLGFENQFWTFGKLPQVEAYFLRFRQRESFHRLQPS 291 >AE014296-931|AAF50802.1| 327|Drosophila melanogaster CG4623-PA protein. Length = 327 Score = 69.3 bits (162), Expect = 5e-12 Identities = 30/58 (51%), Positives = 41/58 (70%) Frame = -2 Query: 717 WLCCENFSIADINLAVLLQRLWELGLETRFWSNGKRPLIESYFERVRQRESFKNTIPN 544 WL + S+ADI+L +LL RL++LG E +FW+ GK P +E+YF R RQRESF P+ Sbjct: 234 WLTGDELSVADISLGLLLHRLYQLGFENQFWTFGKLPQVEAYFLRFRQRESFHRLQPS 291 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,237,107 Number of Sequences: 53049 Number of extensions: 463473 Number of successful extensions: 1150 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1134 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1147 length of database: 24,988,368 effective HSP length: 83 effective length of database: 20,585,301 effective search space used: 3211306956 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -