BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30305 (307 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81088-9|CAB03126.1| 335|Caenorhabditis elegans Hypothetical pr... 26 6.0 Z81088-8|CAB03130.2| 332|Caenorhabditis elegans Hypothetical pr... 25 7.9 >Z81088-9|CAB03126.1| 335|Caenorhabditis elegans Hypothetical protein F53F1.9 protein. Length = 335 Score = 25.8 bits (54), Expect = 6.0 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = +3 Query: 108 ISILTNFTGECFKGLTCNILNINHICNFYFLIF 206 + ++ + G C +G T IL+ +C F IF Sbjct: 93 VFLVITYGGRCIQGATAAILSFCRVCAVCFPIF 125 >Z81088-8|CAB03130.2| 332|Caenorhabditis elegans Hypothetical protein F53F1.8 protein. Length = 332 Score = 25.4 bits (53), Expect = 7.9 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = +3 Query: 108 ISILTNFTGECFKGLTCNILNINHICNFYFLIF 206 I + + G C +G T IL+ +C F IF Sbjct: 97 IFFVITYGGRCIQGATAAILSFCRVCAVCFPIF 129 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,882,276 Number of Sequences: 27780 Number of extensions: 70953 Number of successful extensions: 165 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 165 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 165 length of database: 12,740,198 effective HSP length: 71 effective length of database: 10,767,818 effective search space used: 323034540 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -