BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30304 (678 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC20G4.08 ||SPAC4F10.01|sequence orphan|Schizosaccharomyces po... 28 1.4 SPBC887.14c |pfh1|pif1|pif1 helicase homolog Pfh1|Schizosaccharo... 27 3.3 SPAC23C11.15 |pst2||Clr6 histone deacetylase complex subunit Pst... 25 7.6 >SPAC20G4.08 ||SPAC4F10.01|sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 1076 Score = 27.9 bits (59), Expect = 1.4 Identities = 13/33 (39%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Frame = -2 Query: 320 PLMNSTNQQVRTCL-VSEPVSKDARWEALLARK 225 P+ NST + + L SEPV DA++ ++A+K Sbjct: 564 PIYNSTYELILASLNTSEPVPADAKFSVIVAKK 596 >SPBC887.14c |pfh1|pif1|pif1 helicase homolog Pfh1|Schizosaccharomyces pombe|chr 2|||Manual Length = 805 Score = 26.6 bits (56), Expect = 3.3 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = -2 Query: 551 EEVDEEISVIKKNKLWVRKWIDIR 480 E VD +S IKKNK V +W+ R Sbjct: 389 ESVDLLVSKIKKNKKCVNRWLRTR 412 >SPAC23C11.15 |pst2||Clr6 histone deacetylase complex subunit Pst2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1075 Score = 25.4 bits (53), Expect = 7.6 Identities = 14/51 (27%), Positives = 29/51 (56%), Gaps = 1/51 (1%) Frame = -2 Query: 626 VFYKMNTLQRNRMNKLIKLI-VMAILEEVDEEISVIKKNKLWVRKWIDIRD 477 VF+++ L R+ +L +L ++I+++ V +K K+W +W D+ D Sbjct: 751 VFFRLFNLLYERLYELQRLEDQVSIIQQRIIPNPVSQKQKIWRDRWNDLSD 801 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,537,329 Number of Sequences: 5004 Number of extensions: 46741 Number of successful extensions: 97 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 97 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 97 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 311890690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -