Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= maV30300
         (727 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF000632-1|AAC61894.1|  452|Apis mellifera major royal jelly pro...    22   6.8  
AY736135-1|AAU84701.1|  253|Apis mellifera take-out-like carrier...    21   9.0  
AY395073-1|AAQ96729.1|  203|Apis mellifera GABA neurotransmitter...    21   9.0  
AY395072-1|AAQ96728.1|  593|Apis mellifera GABA neurotransmitter...    21   9.0  
AY395071-1|AAQ96727.1|  646|Apis mellifera GABA neurotransmitter...    21   9.0  
AM420631-1|CAM06631.1|  153|Apis mellifera bursicon subunit alph...    21   9.0  

>AF000632-1|AAC61894.1|  452|Apis mellifera major royal jelly
           protein MRJP2 protein.
          Length = 452

 Score = 21.8 bits (44), Expect = 6.8
 Identities = 11/34 (32%), Positives = 17/34 (50%)
 Frame = -3

Query: 683 CSLETTCWKCLISQASRLWLQFGSLLMRFVIVAS 582
           CS   + +K  I +  RLW+    L+ R V V +
Sbjct: 119 CSKIVSAFKIAIDKFDRLWVLDSGLVNRTVPVCA 152


>AY736135-1|AAU84701.1|  253|Apis mellifera take-out-like carrier
           protein JHBP-1 protein.
          Length = 253

 Score = 21.4 bits (43), Expect = 9.0
 Identities = 8/17 (47%), Positives = 13/17 (76%)
 Frame = +1

Query: 181 TKIPSTVTSGVPFEEIF 231
           TKI + + + VPF++IF
Sbjct: 234 TKIDNEIFNRVPFDKIF 250


>AY395073-1|AAQ96729.1|  203|Apis mellifera GABA neurotransmitter
           transporter-1A protein.
          Length = 203

 Score = 21.4 bits (43), Expect = 9.0
 Identities = 6/7 (85%), Positives = 6/7 (85%)
 Frame = -1

Query: 121 WTFPYLC 101
           W FPYLC
Sbjct: 5   WRFPYLC 11


>AY395072-1|AAQ96728.1|  593|Apis mellifera GABA neurotransmitter
           transporter-1B protein.
          Length = 593

 Score = 21.4 bits (43), Expect = 9.0
 Identities = 6/7 (85%), Positives = 6/7 (85%)
 Frame = -1

Query: 121 WTFPYLC 101
           W FPYLC
Sbjct: 43  WRFPYLC 49


>AY395071-1|AAQ96727.1|  646|Apis mellifera GABA neurotransmitter
           transporter-1B protein.
          Length = 646

 Score = 21.4 bits (43), Expect = 9.0
 Identities = 6/7 (85%), Positives = 6/7 (85%)
 Frame = -1

Query: 121 WTFPYLC 101
           W FPYLC
Sbjct: 96  WRFPYLC 102


>AM420631-1|CAM06631.1|  153|Apis mellifera bursicon subunit alpha
           protein precursor protein.
          Length = 153

 Score = 21.4 bits (43), Expect = 9.0
 Identities = 7/10 (70%), Positives = 7/10 (70%)
 Frame = -3

Query: 299 WQRERSTDCC 270
           WQ ERS  CC
Sbjct: 69  WQMERSCMCC 78


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 169,355
Number of Sequences: 438
Number of extensions: 3419
Number of successful extensions: 10
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 10
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10
length of database: 146,343
effective HSP length: 56
effective length of database: 121,815
effective search space used: 22535775
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)