BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30298 (787 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_5366| Best HMM Match : LRR_1 (HMM E-Value=0.00075) 29 4.3 SB_33793| Best HMM Match : 7tm_1 (HMM E-Value=9.99967e-42) 28 9.9 >SB_5366| Best HMM Match : LRR_1 (HMM E-Value=0.00075) Length = 310 Score = 29.1 bits (62), Expect = 4.3 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = -2 Query: 168 RSIRPHRICLKVLTTCSRHRQPTRVIEPTCPKKYLLLSK 52 R+ R HR C ++ T SR +P + P P + L S+ Sbjct: 105 RNARSHRFCPRMQTALSRDDKPVSTVPPDTPIQKWLYSE 143 >SB_33793| Best HMM Match : 7tm_1 (HMM E-Value=9.99967e-42) Length = 315 Score = 27.9 bits (59), Expect = 9.9 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = -3 Query: 119 PVTGSQQG**SRHVLKNIYCCLNKSKPSKTLDKQTE 12 PV + G RH LK + CL K KP +T D+ T+ Sbjct: 280 PVIYTLHGQRYRHYLKKLLICLRK-KPKQTRDEDTK 314 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,214,702 Number of Sequences: 59808 Number of extensions: 388917 Number of successful extensions: 648 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 623 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 648 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2155861620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -