BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30298 (787 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U29381-7|AAA68755.1| 225|Caenorhabditis elegans Hypothetical pr... 29 5.0 >U29381-7|AAA68755.1| 225|Caenorhabditis elegans Hypothetical protein F35D11.9 protein. Length = 225 Score = 28.7 bits (61), Expect = 5.0 Identities = 17/56 (30%), Positives = 23/56 (41%), Gaps = 2/56 (3%) Frame = +2 Query: 8 RFLSVCQAFLTA*IYLDSNRYFLGHVGSITLVGCR*REHVVN--TFKQILCGRIDL 169 RF C A A Y + +F G L+GC + N + +LCGR L Sbjct: 170 RFTRDCNALTDAYYYFSNGTHFYAVDGRTELLGCFGEKDKQNKHEYSSVLCGRFPL 225 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,762,781 Number of Sequences: 27780 Number of extensions: 293648 Number of successful extensions: 574 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 542 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 574 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1903721438 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -