BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30296 (757 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A6SIM4 Cluster: Putative uncharacterized protein; n=2; ... 36 1.4 >UniRef50_A6SIM4 Cluster: Putative uncharacterized protein; n=2; Sclerotiniaceae|Rep: Putative uncharacterized protein - Botryotinia fuckeliana B05.10 Length = 315 Score = 35.5 bits (78), Expect = 1.4 Identities = 16/54 (29%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = +2 Query: 335 NTPHSAYHVARVQHIHTLHLCSVCE*ERGVTSHCIRIMKSLSIFLSRG-LAHEC 493 N H ++A + IH LH+ S+C+ + ++H + I L F+ + L EC Sbjct: 217 NVKHDIENIAGILSIHELHIWSLCQRKTVASAHIVTIETDLKAFMKQAKLIREC 270 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 600,830,007 Number of Sequences: 1657284 Number of extensions: 9919738 Number of successful extensions: 20686 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 20058 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20683 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 62558016040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -