BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30294 (749 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 25 0.65 EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 23 2.6 AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. 23 3.4 U81038-1|AAB39355.1| 412|Tribolium castaneum transcription fact... 21 8.0 AJ005422-1|CAA06528.1| 287|Tribolium castaneum caudal protein p... 21 8.0 AJ005421-1|CAA06527.1| 249|Tribolium castaneum caudal protein p... 21 8.0 AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. 21 8.0 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 25.0 bits (52), Expect = 0.65 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = -3 Query: 594 TTPA-TNPRRPRVAAC*PVSSDIKDLVKESMPISSCAVKKASVF 466 T+P+ TN + P SSD+ L+KE+MP+ V+ V+ Sbjct: 424 TSPSNTNTSTSSTNSNKPNSSDLNMLIKETMPLPRKLVRGQDVW 467 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 23.0 bits (47), Expect = 2.6 Identities = 14/36 (38%), Positives = 19/36 (52%), Gaps = 3/36 (8%) Frame = -1 Query: 482 RKLRSFQGHVSIRSTPDSFVS---S*PRCVTAREFR 384 RK S H S + T DSF+S S +C + RE + Sbjct: 385 RKSTSSSTHTSSQQTSDSFLSKRNSEKKCGSLREIK 420 >AY531877-1|AAT08872.1| 247|Tribolium castaneum ORF1p protein. Length = 247 Score = 22.6 bits (46), Expect = 3.4 Identities = 8/22 (36%), Positives = 17/22 (77%) Frame = -3 Query: 540 SSDIKDLVKESMPISSCAVKKA 475 + +IKDL+++ PI++C + +A Sbjct: 34 TEEIKDLLQKYPPIANCKLVQA 55 >U81038-1|AAB39355.1| 412|Tribolium castaneum transcription factor Deformed protein. Length = 412 Score = 21.4 bits (43), Expect = 8.0 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = -3 Query: 663 RRKTLPLEIRHSIRSNAGTRSRWTTPATN 577 RRKT P + + + +++ TPA N Sbjct: 301 RRKTNPAGVTTTTKGKVRAKTQNATPANN 329 >AJ005422-1|CAA06528.1| 287|Tribolium castaneum caudal protein protein. Length = 287 Score = 21.4 bits (43), Expect = 8.0 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +3 Query: 255 ANSGTSRPRCTKMVSTFPPSRKP 323 A SG P+ V+ PP+R P Sbjct: 101 AGSGNLSPQIQTQVARPPPARSP 123 >AJ005421-1|CAA06527.1| 249|Tribolium castaneum caudal protein protein. Length = 249 Score = 21.4 bits (43), Expect = 8.0 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +3 Query: 255 ANSGTSRPRCTKMVSTFPPSRKP 323 A SG P+ V+ PP+R P Sbjct: 101 AGSGNLSPQIQTQVARPPPARSP 123 >AF321227-3|AAK16423.1| 412|Tribolium castaneum Dfd protein. Length = 412 Score = 21.4 bits (43), Expect = 8.0 Identities = 9/29 (31%), Positives = 15/29 (51%) Frame = -3 Query: 663 RRKTLPLEIRHSIRSNAGTRSRWTTPATN 577 RRKT P + + + +++ TPA N Sbjct: 301 RRKTNPAGVTTTTKGKVRAKTQNATPANN 329 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 179,014 Number of Sequences: 336 Number of extensions: 4101 Number of successful extensions: 16 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20027417 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -