BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30294 (749 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_48843| Best HMM Match : V_ATPase_I (HMM E-Value=0) 96 3e-42 SB_18046| Best HMM Match : RVT_1 (HMM E-Value=0.34) 36 0.027 SB_25425| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.11 SB_53979| Best HMM Match : TetR_C (HMM E-Value=5.3) 34 0.14 SB_49429| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_39617| Best HMM Match : RVT_1 (HMM E-Value=4.7e-38) 34 0.14 SB_29623| Best HMM Match : GM_CSF (HMM E-Value=5) 34 0.14 SB_23788| Best HMM Match : RVT_1 (HMM E-Value=4.7e-38) 34 0.14 SB_19517| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_17897| Best HMM Match : Ldl_recept_a (HMM E-Value=1.2e-14) 34 0.14 SB_9562| Best HMM Match : TetR_C (HMM E-Value=4) 34 0.14 SB_46950| Best HMM Match : zf-CCHC (HMM E-Value=0.0015) 33 0.25 SB_45147| Best HMM Match : zf-CCHC (HMM E-Value=0.0051) 33 0.25 SB_56000| Best HMM Match : HSA (HMM E-Value=2.8) 32 0.43 SB_9496| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.57 SB_49747| Best HMM Match : RVT_1 (HMM E-Value=2.1e-36) 32 0.57 SB_44878| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_56455| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_50638| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.00033) 30 2.3 SB_20424| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_27052| Best HMM Match : Clathrin (HMM E-Value=3.3) 29 3.0 SB_53902| Best HMM Match : PSI (HMM E-Value=8.7) 29 4.0 SB_14816| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.0 SB_34626| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.3 SB_15062| Best HMM Match : Tctex-1 (HMM E-Value=9.8e-19) 29 5.3 SB_42811| Best HMM Match : SRCR (HMM E-Value=0) 28 7.0 SB_25918| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.0 SB_55168| Best HMM Match : rve (HMM E-Value=2.2e-17) 28 9.3 SB_50139| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 SB_26408| Best HMM Match : Lipase (HMM E-Value=0) 28 9.3 SB_24087| Best HMM Match : rve (HMM E-Value=2.2e-17) 28 9.3 SB_32130| Best HMM Match : TSP_1 (HMM E-Value=0) 28 9.3 SB_1704| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.3 >SB_48843| Best HMM Match : V_ATPase_I (HMM E-Value=0) Length = 1128 Score = 96.3 bits (229), Expect(2) = 3e-42 Identities = 42/85 (49%), Positives = 63/85 (74%) Frame = +2 Query: 494 EEIGMDSLTKSLISDETGQQAATRGRLGFVAGVVQRERVPAFERMLWRISRGNVFLRRAE 673 +E G T L+ +E +A +LGFV+GV+ RE+VP+FER+LWR RGNVF ++AE Sbjct: 175 QEPGRTDDTVQLLGEEPSAASAAT-QLGFVSGVISREKVPSFERLLWRACRGNVFFKQAE 233 Query: 674 LDKPLEDPATGNEIYKTVFVAFFQG 748 +++ LEDP+TG++++K VF+ FFQG Sbjct: 234 IEEALEDPSTGDQVHKCVFIIFFQG 258 Score = 94.3 bits (224), Expect(2) = 3e-42 Identities = 50/106 (47%), Positives = 71/106 (66%), Gaps = 2/106 (1%) Frame = +2 Query: 86 SEEMALCQLFIQPEAAYTSVSELGE-AGSVQFRD-LNPDVNAFQRKFVNEVRRCDEMERK 259 ++E+ + +F++ ++ Y S GE GS R LNPDVNAFQRKFVNEVRRC+EMERK Sbjct: 72 AKELLIGCMFLR-DSVYFSAEFYGEFEGSYVIRQSLNPDVNAFQRKFVNEVRRCEEMERK 130 Query: 260 LRYIEAEVHKDGVHIPAVKEAPRAPNPREIIDLEAHLEKTENEILE 397 LR+++ E+ K + + E+ AP+PRE+IDLEA + +I E Sbjct: 131 LRFLQKEIEKAEIAMVDTGESSEAPHPREMIDLEAEQHVHQQQIQE 176 >SB_18046| Best HMM Match : RVT_1 (HMM E-Value=0.34) Length = 837 Score = 36.3 bits (80), Expect = 0.027 Identities = 17/56 (30%), Positives = 31/56 (55%), Gaps = 2/56 (3%) Frame = +2 Query: 209 QRKFVNEVRRCDEMERKLRYIEAEVHKDGVHIPA--VKEAPRAPNPREIIDLEAHL 370 Q K + +C+ M+ L+Y+ + KDG+H + V+ AP+P+++ L A L Sbjct: 277 QEKMXAQREKCEFMQPSLKYLGHVIDKDGIHPTSDKVEAIKTAPSPQDVTQLRAFL 332 >SB_25425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 766 Score = 34.3 bits (75), Expect = 0.11 Identities = 17/48 (35%), Positives = 29/48 (60%), Gaps = 3/48 (6%) Frame = +2 Query: 236 RCDEMERKLRYIEAEVHKDGVHIPA---VKEAPRAPNPREIIDLEAHL 370 +C+ M+ L+Y+ + KDG+H PA V+ AP+P+++ L A L Sbjct: 62 KCEFMQPSLKYLGHVIDKDGIH-PASDKVEAIKTAPSPQDVTQLRAFL 108 >SB_53979| Best HMM Match : TetR_C (HMM E-Value=5.3) Length = 327 Score = 33.9 bits (74), Expect = 0.14 Identities = 15/47 (31%), Positives = 28/47 (59%), Gaps = 2/47 (4%) Frame = +2 Query: 236 RCDEMERKLRYIEAEVHKDGVHIPA--VKEAPRAPNPREIIDLEAHL 370 +C+ M+ L+Y+ + KDG+H + V+ AP+P+++ L A L Sbjct: 50 KCEFMQPSLKYLGHVIDKDGIHPTSDKVEAIKTAPSPQDVTQLRAFL 96 >SB_49429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 918 Score = 33.9 bits (74), Expect = 0.14 Identities = 15/47 (31%), Positives = 28/47 (59%), Gaps = 2/47 (4%) Frame = +2 Query: 236 RCDEMERKLRYIEAEVHKDGVHIPA--VKEAPRAPNPREIIDLEAHL 370 +C+ M+ L+Y+ + KDG+H + V+ AP+P+++ L A L Sbjct: 463 KCEFMQPSLKYLGHVIDKDGIHPTSDKVEAIKTAPSPQDVTQLRAFL 509 >SB_39617| Best HMM Match : RVT_1 (HMM E-Value=4.7e-38) Length = 1084 Score = 33.9 bits (74), Expect = 0.14 Identities = 15/47 (31%), Positives = 28/47 (59%), Gaps = 2/47 (4%) Frame = +2 Query: 236 RCDEMERKLRYIEAEVHKDGVHIPA--VKEAPRAPNPREIIDLEAHL 370 +C+ M+ L+Y+ + KDG+H + V+ AP+P+++ L A L Sbjct: 608 KCEFMQPSLKYLGHVIDKDGIHPTSDKVEAIKTAPSPQDVTQLRAFL 654 >SB_29623| Best HMM Match : GM_CSF (HMM E-Value=5) Length = 296 Score = 33.9 bits (74), Expect = 0.14 Identities = 15/47 (31%), Positives = 28/47 (59%), Gaps = 2/47 (4%) Frame = +2 Query: 236 RCDEMERKLRYIEAEVHKDGVHIPA--VKEAPRAPNPREIIDLEAHL 370 +C+ M+ L+Y+ + KDG+H + V+ AP+P+++ L A L Sbjct: 29 KCEFMQPSLKYLGHVIDKDGIHPTSDKVEAIKTAPSPQDVTQLRAFL 75 >SB_23788| Best HMM Match : RVT_1 (HMM E-Value=4.7e-38) Length = 1122 Score = 33.9 bits (74), Expect = 0.14 Identities = 15/47 (31%), Positives = 28/47 (59%), Gaps = 2/47 (4%) Frame = +2 Query: 236 RCDEMERKLRYIEAEVHKDGVHIPA--VKEAPRAPNPREIIDLEAHL 370 +C+ M+ L+Y+ + KDG+H + V+ AP+P+++ L A L Sbjct: 642 KCEFMQPSLKYLGHVIDKDGIHPTSDKVEAIKTAPSPQDVTQLRAFL 688 >SB_19517| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1696 Score = 33.9 bits (74), Expect = 0.14 Identities = 15/47 (31%), Positives = 28/47 (59%), Gaps = 2/47 (4%) Frame = +2 Query: 236 RCDEMERKLRYIEAEVHKDGVHIPA--VKEAPRAPNPREIIDLEAHL 370 +C+ M+ L+Y+ + KDG+H + V+ AP+P+++ L A L Sbjct: 685 KCEFMQPSLKYLGHVIDKDGIHPTSDKVEAIKTAPSPQDVTQLRAFL 731 >SB_17897| Best HMM Match : Ldl_recept_a (HMM E-Value=1.2e-14) Length = 1217 Score = 33.9 bits (74), Expect = 0.14 Identities = 15/47 (31%), Positives = 28/47 (59%), Gaps = 2/47 (4%) Frame = +2 Query: 236 RCDEMERKLRYIEAEVHKDGVHIPA--VKEAPRAPNPREIIDLEAHL 370 +C+ M+ L+Y+ + KDG+H + V+ AP+P+++ L A L Sbjct: 415 KCEFMQPSLKYLGHVIDKDGIHPTSDKVEAIKTAPSPQDVTQLRAFL 461 >SB_9562| Best HMM Match : TetR_C (HMM E-Value=4) Length = 242 Score = 33.9 bits (74), Expect = 0.14 Identities = 15/47 (31%), Positives = 28/47 (59%), Gaps = 2/47 (4%) Frame = +2 Query: 236 RCDEMERKLRYIEAEVHKDGVHIPA--VKEAPRAPNPREIIDLEAHL 370 +C+ M+ L+Y+ + KDG+H + V+ AP+P+++ L A L Sbjct: 80 KCEFMQPSLKYLGHVIDKDGIHPTSDKVEAIKTAPSPQDVTQLRAFL 126 >SB_46950| Best HMM Match : zf-CCHC (HMM E-Value=0.0015) Length = 797 Score = 33.1 bits (72), Expect = 0.25 Identities = 15/47 (31%), Positives = 28/47 (59%), Gaps = 2/47 (4%) Frame = +2 Query: 236 RCDEMERKLRYIEAEVHKDGVHIPA--VKEAPRAPNPREIIDLEAHL 370 +C+ M+ L+Y+ + KDG+H + V+ AP+P+++ L A L Sbjct: 497 KCEFMQPPLKYLGHIIDKDGIHPTSDKVEAIKTAPSPQDVTQLRAFL 543 >SB_45147| Best HMM Match : zf-CCHC (HMM E-Value=0.0051) Length = 522 Score = 33.1 bits (72), Expect = 0.25 Identities = 16/48 (33%), Positives = 29/48 (60%), Gaps = 3/48 (6%) Frame = +2 Query: 236 RCDEMERKLRYIEAEVHKDGVHIPA---VKEAPRAPNPREIIDLEAHL 370 +C+ M+ L+Y+ + KDG+H PA ++ AP+P+++ L A L Sbjct: 326 KCEFMQPSLKYLGHVIDKDGIH-PASDKLETIKTAPSPQDVTQLRAFL 372 >SB_56000| Best HMM Match : HSA (HMM E-Value=2.8) Length = 410 Score = 32.3 bits (70), Expect = 0.43 Identities = 14/42 (33%), Positives = 23/42 (54%) Frame = -3 Query: 390 ISFSVFSKCASKSMISLGLGARGASLTAGMWTPSLCTSASMY 265 + F+ FS+ I+ L AR ++AG+WT C SA+ + Sbjct: 346 LEFAQFSRKRVIEFIAFALWARDCCISAGLWTRDRCISAACF 387 >SB_9496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2309 Score = 31.9 bits (69), Expect = 0.57 Identities = 14/53 (26%), Positives = 29/53 (54%), Gaps = 2/53 (3%) Frame = +2 Query: 236 RCDEMERKLRYIEAEVHKDGVHIPA--VKEAPRAPNPREIIDLEAHLEKTENE 388 +C+ M+ L+Y+ + KDG+H + V+ AP+P+++ L + +E Sbjct: 536 KCEFMQPSLKYLGHVIDKDGIHPTSDKVEAIKTAPSPQDVTQLRLTTSSSTSE 588 >SB_49747| Best HMM Match : RVT_1 (HMM E-Value=2.1e-36) Length = 877 Score = 31.9 bits (69), Expect = 0.57 Identities = 14/53 (26%), Positives = 29/53 (54%), Gaps = 2/53 (3%) Frame = +2 Query: 236 RCDEMERKLRYIEAEVHKDGVHIPA--VKEAPRAPNPREIIDLEAHLEKTENE 388 +C+ M+ L+Y+ + KDG+H + V+ AP+P+++ L + +E Sbjct: 319 KCEFMQPSLKYLGHVIDKDGIHPTSDKVEAIKTAPSPQDVTQLRLTTSSSTSE 371 >SB_44878| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1338 Score = 30.7 bits (66), Expect = 1.3 Identities = 33/130 (25%), Positives = 66/130 (50%), Gaps = 13/130 (10%) Frame = +2 Query: 203 AFQRKFVNEVRRCDEMERKLRYIE---AEVHKDGVHI-PAVKEAPRAPNPREIIDLE-AH 367 A +++ +R+ +++R+L+ +E AEV KDGV I A++ + + + + +E Sbjct: 720 AMKQRESKRLRQAQQIQRELQELEVKQAEVEKDGVVIEKAIRSGELSKSEEQKMMMEWFK 779 Query: 368 LEKTENEILELSHNAVNLKQNYLEL--------TELRHVLEKTEAFFTAQEEIGMDSLTK 523 + +N ++ V + NY++L E+R +L K + T Q++I + TK Sbjct: 780 IINRKNAMIRYESELV-IHANYIQLEDQQGRLEQEIRELLMKEAS--TEQDQIEIQLKTK 836 Query: 524 SLISDETGQQ 553 L+ D GQ+ Sbjct: 837 ELV-DIVGQR 845 >SB_56455| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 325 Score = 30.3 bits (65), Expect = 1.7 Identities = 16/67 (23%), Positives = 34/67 (50%), Gaps = 1/67 (1%) Frame = +2 Query: 206 FQRKFVNEVR-RCDEMERKLRYIEAEVHKDGVHIPAVKEAPRAPNPREIIDLEAHLEKTE 382 + R + E R ++ +R+ R VH+D + + ++KE P P+ II + + E Sbjct: 76 YTRLVIQESRDEYEKQQRQSRENLKRVHEDTLTVQSLKETPAIEPPKNIISQKLNQETNG 135 Query: 383 NEILELS 403 ++ E++ Sbjct: 136 GQLREIT 142 >SB_50638| Best HMM Match : Pox_A_type_inc (HMM E-Value=0.00033) Length = 311 Score = 29.9 bits (64), Expect = 2.3 Identities = 35/124 (28%), Positives = 63/124 (50%), Gaps = 4/124 (3%) Frame = +2 Query: 143 VSELG-EAGSVQFRDLNPDVNAFQRKFVNEVRRCDEMERKL--RYIEAEVHKDGVHIPAV 313 ++E+G E G+V+ R L +V + + + + R KL +Y E E KD + ++ Sbjct: 85 MAEIGVEKGNVE-RSLE-EVQSQNKDLMQQAERAKAELAKLSAKYEELEDEKDEMQ-ESL 141 Query: 314 KEAPRAPNPREIIDLEAHLEKTENEILELSHNAVNLKQNYLELTELR-HVLEKTEAFFTA 490 + R + REI DLEA LE +E + +L + N + L ++L+ +++ E A Sbjct: 142 SDTIREKS-REIRDLEADLEMSEQKYEDLKSSWNNTE---LVTSDLQGELMQAREEVIRA 197 Query: 491 QEEI 502 Q E+ Sbjct: 198 QSEV 201 >SB_20424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1711 Score = 29.9 bits (64), Expect = 2.3 Identities = 28/98 (28%), Positives = 43/98 (43%), Gaps = 4/98 (4%) Frame = +2 Query: 194 DVNAFQRKFVNEVRRCDEMERKLR---YIEAEVHKDGVHIPAVKEAPRAPNPREIIDLEA 364 D+ A Q + + E++R E R ++ E E D +H + + RE+ DL+ Sbjct: 1215 DIRAQQLEEIEELKRQIEHMRDVQNNYQKELEAKDDSLHY---LQDSKKEMMRELEDLKE 1271 Query: 365 HLEKTENEILELSHN-AVNLKQNYLELTELRHVLEKTE 475 L K ENE+ E + V NY + EL K E Sbjct: 1272 MLHKKENELAEQAERIRVFESNNYGDAKELYETCNKLE 1309 >SB_27052| Best HMM Match : Clathrin (HMM E-Value=3.3) Length = 203 Score = 29.5 bits (63), Expect = 3.0 Identities = 24/97 (24%), Positives = 44/97 (45%), Gaps = 5/97 (5%) Frame = +2 Query: 245 EMERKLRYIEAEVHKDGVHIPAVKEAPRAPNPREIIDLEAHLEKTE----NEILEL-SHN 409 E+ +E H++ V + +E RE+++L H E E E++EL H Sbjct: 14 ELVEHRELVELVEHRELVELVEHRELVELVEHRELVELVEHRELVELVEHRELVELVEHR 73 Query: 410 AVNLKQNYLELTELRHVLEKTEAFFTAQEEIGMDSLT 520 + + +EL E R ++E E F + + ++S T Sbjct: 74 ELVEHRELVELVEHRELVEHRELGFLSILDARVNSNT 110 Score = 28.7 bits (61), Expect = 5.3 Identities = 24/99 (24%), Positives = 44/99 (44%), Gaps = 6/99 (6%) Frame = +2 Query: 266 YIEAEVHKDGVHIPAVKEAPRAPNPREIIDLEAHLEKTE----NEILEL-SHNAVNLKQN 430 ++E H++ V + +E RE+++L H E E E++EL H + Sbjct: 12 HLELVEHRELVELVEHRELVELVEHRELVELVEHRELVELVEHRELVELVEHRELVELVE 71 Query: 431 YLELTELRHVLEKTE-AFFTAQEEIGMDSLTKSLISDET 544 + EL E R ++E E E+G S+ + ++ T Sbjct: 72 HRELVEHRELVELVEHRELVEHRELGFLSILDARVNSNT 110 >SB_53902| Best HMM Match : PSI (HMM E-Value=8.7) Length = 139 Score = 29.1 bits (62), Expect = 4.0 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = +3 Query: 630 CGVSREATSSCDVLNWTSRSKIL 698 CGV+R +SC V W+S K L Sbjct: 82 CGVTRSQPASCSVAEWSSLQKCL 104 >SB_14816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3760 Score = 29.1 bits (62), Expect = 4.0 Identities = 26/99 (26%), Positives = 50/99 (50%), Gaps = 3/99 (3%) Frame = +2 Query: 152 LGEAGSVQFRDLNPDVNAFQRKFVNEVRRCDE--MERKLRYIEAEVHKDGVHIPAVKEAP 325 L +A +VQ +L D+ Q++ E+R+ +E +RKL +E +V + Sbjct: 3032 LRQADNVQL-NLRKDLEDLQKE-KEELRKENENLKKRKLSIVE-KVKVTSSECAVASQVS 3088 Query: 326 RAPN-PREIIDLEAHLEKTENEILELSHNAVNLKQNYLE 439 + P+ E + + +E +NEI+ L + A NL++ L+ Sbjct: 3089 QVPDLGSEPVAKASSMESAQNEIIMLENQAKNLRKQILK 3127 >SB_34626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 28.7 bits (61), Expect = 5.3 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = -1 Query: 554 LVDQSRQILKTWSKNPCRFPPVR*RKLRSFQGHVSI 447 L +++ + K W + P RFP R + R F GH S+ Sbjct: 16 LREKTEKPQKGWIRKPFRFPNFRAKTERKFTGHDSL 51 >SB_15062| Best HMM Match : Tctex-1 (HMM E-Value=9.8e-19) Length = 851 Score = 28.7 bits (61), Expect = 5.3 Identities = 18/54 (33%), Positives = 27/54 (50%) Frame = +1 Query: 292 WCPHSRRQGSPPCSQPEGNH*LRGTFRENRKRNSRAVTQRGQLETKLSGVDRIE 453 W P SRR+ P ++P + GT R +R R R + R +L + V R+E Sbjct: 593 WKPFSRRKARPSSARPRS---IFGTSRTSRHRRRRRIVARLRLRVHRTQV-RLE 642 >SB_42811| Best HMM Match : SRCR (HMM E-Value=0) Length = 854 Score = 28.3 bits (60), Expect = 7.0 Identities = 12/37 (32%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = +3 Query: 591 WSSASACPHSNGCCGVSREATSSCDVLNWT-SRSKIL 698 +S +C NG CG + + S D L+W +R +L Sbjct: 141 YSGTGSCNFENGMCGYANDLLPSNDQLDWALTRPNVL 177 >SB_25918| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 28.3 bits (60), Expect = 7.0 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = +1 Query: 238 LR*NGTQTPVHRGRGAQRWCPHSRRQGSPPCSQPE 342 LR T P+ G Q W P R+ P C PE Sbjct: 51 LRAENTVNPLGEGEHLQTWVPPLRKGQGPLCPAPE 85 >SB_55168| Best HMM Match : rve (HMM E-Value=2.2e-17) Length = 1017 Score = 27.9 bits (59), Expect = 9.3 Identities = 15/56 (26%), Positives = 22/56 (39%) Frame = -2 Query: 727 HGLVDLVTRSRIFERLVQFSTSQEDVASRDTPQHPFECGHALALDHARNEPEAAAS 560 H D ++R + T +D+A+ D P ALA R PE + S Sbjct: 434 HNAADAISRHPTGSTTPEMMTLPDDIATIDASNSPHPANAALASLRTREPPEESCS 489 >SB_50139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2211 Score = 27.9 bits (59), Expect = 9.3 Identities = 20/64 (31%), Positives = 29/64 (45%) Frame = +3 Query: 537 TRLVNKRPLAAASGSLRAWSSASACPHSNGCCGVSREATSSCDVLNWTSRSKILLRVTRS 716 TR K P +G +SS S+C S C G +R T +C +S K + + + Sbjct: 370 TRECGKAP-CPVNGGWSDYSSWSSCTKS--CGGGTRTRTRTCTNPKPSSGGKDCVGIAKQ 426 Query: 717 TRPC 728 TR C Sbjct: 427 TREC 430 >SB_26408| Best HMM Match : Lipase (HMM E-Value=0) Length = 714 Score = 27.9 bits (59), Expect = 9.3 Identities = 16/51 (31%), Positives = 24/51 (47%) Frame = +2 Query: 161 AGSVQFRDLNPDVNAFQRKFVNEVRRCDEMERKLRYIEAEVHKDGVHIPAV 313 +GS FR D ++RK++ C +RYIEA + G +P V Sbjct: 348 SGSFYFR--TTDTAPYRRKYLTLDTDCFSRFTSIRYIEAAPYPGGPQLPKV 396 >SB_24087| Best HMM Match : rve (HMM E-Value=2.2e-17) Length = 1229 Score = 27.9 bits (59), Expect = 9.3 Identities = 17/64 (26%), Positives = 25/64 (39%) Frame = -2 Query: 727 HGLVDLVTRSRIFERLVQFSTSQEDVASRDTPQHPFECGHALALDHARNEPEAAASGRLL 548 H D ++R + T +D+A+ D P ALA R PE + S + Sbjct: 681 HKAADAISRHPTGSTTPEMMTLPDDIATIDASNSPHPANAALASLRTREPPEESCSYEID 740 Query: 547 TSLV 536 LV Sbjct: 741 KELV 744 >SB_32130| Best HMM Match : TSP_1 (HMM E-Value=0) Length = 446 Score = 27.9 bits (59), Expect = 9.3 Identities = 20/64 (31%), Positives = 29/64 (45%) Frame = +3 Query: 537 TRLVNKRPLAAASGSLRAWSSASACPHSNGCCGVSREATSSCDVLNWTSRSKILLRVTRS 716 TR K P +G +SS S+C S C G +R T +C +S K + + + Sbjct: 285 TRECGKAP-CPVNGGWSDYSSWSSCTKS--CGGGTRTRTRTCTNPKPSSGGKDCVGIAKQ 341 Query: 717 TRPC 728 TR C Sbjct: 342 TREC 345 >SB_1704| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 316 Score = 27.9 bits (59), Expect = 9.3 Identities = 15/56 (26%), Positives = 23/56 (41%) Frame = -2 Query: 727 HGLVDLVTRSRIFERLVQFSTSQEDVASRDTPQHPFECGHALALDHARNEPEAAAS 560 H D ++R + + T +D+A+ D P ALA R PE + S Sbjct: 174 HKAADAISRHPMGSTTPEMMTLPDDIATIDASNSPHPANAALASLRTREPPEESCS 229 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,086,686 Number of Sequences: 59808 Number of extensions: 563350 Number of successful extensions: 1791 Number of sequences better than 10.0: 33 Number of HSP's better than 10.0 without gapping: 1624 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1786 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2034222073 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -