BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30293 (758 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p... 27 0.83 EF989011-1|ABS17666.1| 399|Anopheles gambiae serpin 7 protein. 25 2.5 DQ974173-1|ABJ52813.1| 553|Anopheles gambiae serpin 16 protein. 25 3.3 AF004915-1|AAB94671.1| 688|Anopheles gambiae pro-phenol oxidase... 24 4.4 DQ139945-1|ABA29466.1| 399|Anopheles gambiae protein O-fucosylt... 24 5.9 DQ974168-1|ABJ52808.1| 447|Anopheles gambiae serpin 9 protein. 23 7.7 AY146717-1|AAO12077.1| 188|Anopheles gambiae odorant-binding pr... 23 7.7 >AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein protein. Length = 1077 Score = 26.6 bits (56), Expect = 0.83 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = +1 Query: 445 GDLNVVYL-VNSGSEANELATLLAKAYTGNLDIISLQTSYH 564 G N+ + +N+ S A +L L T +LD+I LQ YH Sbjct: 14 GSCNIASININTISSATKLEALKTFIRTMDLDVIFLQEVYH 54 >EF989011-1|ABS17666.1| 399|Anopheles gambiae serpin 7 protein. Length = 399 Score = 25.0 bits (52), Expect = 2.5 Identities = 12/24 (50%), Positives = 18/24 (75%) Frame = +2 Query: 656 LILSXALSEAAGTLSRKLQDPARA 727 L +S AL ++ G LS++L+D ARA Sbjct: 120 LNVSFALLQSEGQLSQELEDAARA 143 >DQ974173-1|ABJ52813.1| 553|Anopheles gambiae serpin 16 protein. Length = 553 Score = 24.6 bits (51), Expect = 3.3 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 377 IRPTCTDIRKSMSTSNN 427 ++P+ TDIR+ S SNN Sbjct: 452 LQPSSTDIRRGTSNSNN 468 >AF004915-1|AAB94671.1| 688|Anopheles gambiae pro-phenol oxidase subunit 1 protein. Length = 688 Score = 24.2 bits (50), Expect = 4.4 Identities = 17/52 (32%), Positives = 23/52 (44%) Frame = +1 Query: 268 DGKRYLDLFGGIVTVSVGHCHPKVNAALKDQLDVLWHTTNLYRHPKIYEYVE 423 D +R +D+ G +V S P NA L L + H Y H Y Y+E Sbjct: 336 DEQRGIDILGDVVEAS--SLTP--NAQLYGSLHNMGHNVIAYVHDPDYRYLE 383 >DQ139945-1|ABA29466.1| 399|Anopheles gambiae protein O-fucosyltransferase 1 protein. Length = 399 Score = 23.8 bits (49), Expect = 5.9 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = -1 Query: 122 VGGILAVLYVLTMSKHNFVPLLAISMCFSVEAIAICHT 9 VG + A V+TM NF+ LA S+ E I+ C+T Sbjct: 82 VGPLQAFHRVITME--NFMKTLAPSLWPPAERISFCYT 117 >DQ974168-1|ABJ52808.1| 447|Anopheles gambiae serpin 9 protein. Length = 447 Score = 23.4 bits (48), Expect = 7.7 Identities = 9/25 (36%), Positives = 12/25 (48%) Frame = +1 Query: 592 TATQSYRMAIPVPPGFYHAVHPDPF 666 T S+R + P P +H HP F Sbjct: 403 TVAFSFRSSRPADPAMFHCNHPFVF 427 >AY146717-1|AAO12077.1| 188|Anopheles gambiae odorant-binding protein AgamOBP14 protein. Length = 188 Score = 23.4 bits (48), Expect = 7.7 Identities = 9/30 (30%), Positives = 16/30 (53%) Frame = +3 Query: 300 NRHRLRGPLSSESKCSPQRSTRCIVAYDQP 389 +RH L+ L + C Q++ +C+ A P Sbjct: 107 DRHYLQYGLGQDYNCFRQKAEQCLAANTSP 136 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 837,513 Number of Sequences: 2352 Number of extensions: 18487 Number of successful extensions: 89 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 87 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 89 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 78586767 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -