BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30292 (770 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16632| Best HMM Match : HSP20 (HMM E-Value=1e-12) 71 1e-12 SB_21425| Best HMM Match : HSP20 (HMM E-Value=1.9e-26) 66 4e-11 SB_58906| Best HMM Match : HSP20 (HMM E-Value=3e-26) 55 6e-08 SB_21424| Best HMM Match : HSP20 (HMM E-Value=0) 55 6e-08 SB_3291| Best HMM Match : No HMM Matches (HMM E-Value=.) 55 6e-08 SB_49292| Best HMM Match : HSP20 (HMM E-Value=1.9e-29) 55 6e-08 SB_38963| Best HMM Match : HSP20 (HMM E-Value=7.3e-26) 55 6e-08 SB_37349| Best HMM Match : HSP20 (HMM E-Value=7.3e-26) 55 6e-08 SB_58907| Best HMM Match : HSP20 (HMM E-Value=4.2e-05) 41 0.001 SB_18447| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.45 SB_25956| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_39858| Best HMM Match : Spectrin (HMM E-Value=2.6e-05) 30 1.8 SB_3515| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.4 SB_12240| Best HMM Match : IBB (HMM E-Value=9.5) 29 3.1 SB_56248| Best HMM Match : RVT_1 (HMM E-Value=8.6e-20) 29 3.1 SB_59029| Best HMM Match : Pkinase (HMM E-Value=0) 29 4.2 SB_13913| Best HMM Match : WH2 (HMM E-Value=8.8e-05) 29 4.2 SB_24406| Best HMM Match : DUF536 (HMM E-Value=1.5) 29 4.2 SB_27758| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.5 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.3 >SB_16632| Best HMM Match : HSP20 (HMM E-Value=1e-12) Length = 210 Score = 70.5 bits (165), Expect = 1e-12 Identities = 32/85 (37%), Positives = 55/85 (64%), Gaps = 1/85 (1%) Frame = +3 Query: 273 LGSTIKTEKDKFQI-NLDVQHFSPDEISVKTAEGYVVVEAKHEEKQDEHGYISRQFVRKY 449 L + + E DK +I LDV+++ P+EIS+K G + ++ KH+ + EHGY + +F R Y Sbjct: 29 LAANTEMEGDKVEIATLDVKNYRPEEISLKVEHGRIKIDGKHKS-EGEHGYETSEFHRSY 87 Query: 450 SLPEGAETANVVSELSADGILTVTA 524 +LP+G + + V S ++ DG+L + A Sbjct: 88 NLPDGVDVSTVSSRITGDGLLHIEA 112 >SB_21425| Best HMM Match : HSP20 (HMM E-Value=1.9e-26) Length = 185 Score = 65.7 bits (153), Expect = 4e-11 Identities = 35/95 (36%), Positives = 55/95 (57%), Gaps = 1/95 (1%) Frame = +3 Query: 294 EKDKFQI-NLDVQHFSPDEISVKTAEGYVVVEAKHEEKQDEHGYISRQFVRKYSLPEGAE 470 + DKFQI LDV+ F P+EI+ K G + V + +E G+ S++F R Y+LPEG + Sbjct: 2 DADKFQIATLDVREFKPEEITCKVENGKIKVSGLQRHESEE-GFDSKEFRRCYNLPEGVD 60 Query: 471 TANVVSELSADGILTVTAPRKVIDDKGERVVPITK 575 +++ + ++ DG+L V A +K E P TK Sbjct: 61 ESSISTRIAEDGMLHVEALKKSPPATTENKAPATK 95 Score = 51.6 bits (118), Expect = 7e-07 Identities = 28/78 (35%), Positives = 43/78 (55%), Gaps = 1/78 (1%) Frame = +3 Query: 303 KFQINLDVQHFSPDEISVKTAEGYVVVEAKHEEKQDEHGYIS-RQFVRKYSLPEGAETAN 479 KF + LDV F P+E+ VK + V A+ E +EHG+ + RQF R + LP + Sbjct: 99 KFTLALDVSDFKPEEVDVKVYGHELSVRARQE--CEEHGFFTARQFNRHFVLPREVDMDT 156 Query: 480 VVSELSADGILTVTAPRK 533 +V L DG+L + A ++ Sbjct: 157 LVPRLGKDGVLYIEADKR 174 >SB_58906| Best HMM Match : HSP20 (HMM E-Value=3e-26) Length = 695 Score = 55.2 bits (127), Expect = 6e-08 Identities = 29/88 (32%), Positives = 51/88 (57%), Gaps = 1/88 (1%) Frame = +3 Query: 297 KDKFQI-NLDVQHFSPDEISVKTAEGYVVVEAKHEEKQDEHGYISRQFVRKYSLPEGAET 473 ++K +I LDV+ + P+EIS K G V V+ +H + G+ ++F R ++LPEG E Sbjct: 5 ENKLEIAKLDVREYRPEEISFKVENGVVKVQGRH-VNEGPFGFELKEFRRTFTLPEGVEA 63 Query: 474 ANVVSELSADGILTVTAPRKVIDDKGER 557 +NV + +S G L + A + + + G + Sbjct: 64 SNVKTRISNHGQLHIEAMKALPEPDGAK 91 Score = 47.6 bits (108), Expect = 1e-05 Identities = 24/86 (27%), Positives = 47/86 (54%) Frame = +3 Query: 276 GSTIKTEKDKFQINLDVQHFSPDEISVKTAEGYVVVEAKHEEKQDEHGYISRQFVRKYSL 455 G+ +++ DKF + +DV+ F P+ I V+ ++V A HE + + H Y + F R++ L Sbjct: 89 GAKKESKDDKFSMAMDVKGFPPEAIKVQVLGNELLVSANHEVEHEGH-YHAMHFNRQFIL 147 Query: 456 PEGAETANVVSELSADGILTVTAPRK 533 P + ++ + L +G L A ++ Sbjct: 148 PREVDMDSLTTRLDKEGKLHFEAKKR 173 >SB_21424| Best HMM Match : HSP20 (HMM E-Value=0) Length = 424 Score = 55.2 bits (127), Expect = 6e-08 Identities = 28/77 (36%), Positives = 47/77 (61%), Gaps = 1/77 (1%) Frame = +3 Query: 297 KDKFQI-NLDVQHFSPDEISVKTAEGYVVVEAKHEEKQDEHGYISRQFVRKYSLPEGAET 473 ++K +I LDV+ + P+EIS K G+V V+ +H + G+ ++F R ++LPEG E Sbjct: 4 ENKLEIAKLDVREYRPEEISFKVENGFVKVQGRH-VNEGPFGFELKEFRRTFTLPEGVEA 62 Query: 474 ANVVSELSADGILTVTA 524 +NV + +S G L + A Sbjct: 63 SNVKTRISNHGQLHIEA 79 Score = 55.2 bits (127), Expect = 6e-08 Identities = 28/76 (36%), Positives = 46/76 (60%), Gaps = 1/76 (1%) Frame = +3 Query: 300 DKFQI-NLDVQHFSPDEISVKTAEGYVVVEAKHEEKQDEHGYISRQFVRKYSLPEGAETA 476 D+ +I LDV+ + P+EIS K G+V V+ +H + G+ ++F R ++LPEG E + Sbjct: 239 DELEIAKLDVREYRPEEISFKVENGFVKVQGRH-VNEGPFGFELKEFRRTFTLPEGVEAS 297 Query: 477 NVVSELSADGILTVTA 524 NV + +S G L + A Sbjct: 298 NVKTRISNHGQLHIEA 313 Score = 46.8 bits (106), Expect = 2e-05 Identities = 24/78 (30%), Positives = 41/78 (52%) Frame = +3 Query: 300 DKFQINLDVQHFSPDEISVKTAEGYVVVEAKHEEKQDEHGYISRQFVRKYSLPEGAETAN 479 DKF + +DV F PD I V+ ++V A HE + + H Y + F R++ LP + + Sbjct: 97 DKFSMAMDVTGFPPDSIKVQVLGNELLVSANHEVEHEGH-YHAMHFNRQFVLPREVDMDS 155 Query: 480 VVSELSADGILTVTAPRK 533 + + L +G L A ++ Sbjct: 156 LTTRLDKEGKLHFEAKKR 173 Score = 46.8 bits (106), Expect = 2e-05 Identities = 24/78 (30%), Positives = 41/78 (52%) Frame = +3 Query: 300 DKFQINLDVQHFSPDEISVKTAEGYVVVEAKHEEKQDEHGYISRQFVRKYSLPEGAETAN 479 DKF + +DV F PD I V+ ++V A HE + + H Y + F R++ LP + + Sbjct: 331 DKFSMAMDVTGFPPDSIKVQVLGNELLVSANHEVEHEGH-YHAMHFNRQFVLPREVDMDS 389 Query: 480 VVSELSADGILTVTAPRK 533 + + L +G L A ++ Sbjct: 390 LTTRLDKEGKLHFEAKKR 407 >SB_3291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 760 Score = 55.2 bits (127), Expect = 6e-08 Identities = 28/77 (36%), Positives = 47/77 (61%), Gaps = 1/77 (1%) Frame = +3 Query: 297 KDKFQI-NLDVQHFSPDEISVKTAEGYVVVEAKHEEKQDEHGYISRQFVRKYSLPEGAET 473 ++K +I LDV+ + P+EIS K G+V V+ +H + G+ ++F R ++LPEG E Sbjct: 4 ENKLEIAKLDVREYRPEEISFKVENGFVKVQGRH-VNEGPFGFELKEFRRTFTLPEGVEA 62 Query: 474 ANVVSELSADGILTVTA 524 +NV + +S G L + A Sbjct: 63 SNVKTRISNHGQLHIEA 79 Score = 46.8 bits (106), Expect = 2e-05 Identities = 24/78 (30%), Positives = 41/78 (52%) Frame = +3 Query: 300 DKFQINLDVQHFSPDEISVKTAEGYVVVEAKHEEKQDEHGYISRQFVRKYSLPEGAETAN 479 DKF + +DV F PD I V+ ++V A HE + + H Y + F R++ LP + + Sbjct: 97 DKFSMAMDVTGFPPDSIKVQVLGNELLVSANHEVEHEGH-YHAMHFNRQFVLPREVDMDS 155 Query: 480 VVSELSADGILTVTAPRK 533 + + L +G L A ++ Sbjct: 156 LTTRLDKEGKLHFEAKKR 173 >SB_49292| Best HMM Match : HSP20 (HMM E-Value=1.9e-29) Length = 189 Score = 55.2 bits (127), Expect = 6e-08 Identities = 31/83 (37%), Positives = 49/83 (59%), Gaps = 1/83 (1%) Frame = +3 Query: 294 EKDKFQI-NLDVQHFSPDEISVKTAEGYVVVEAKHEEKQDEHGYISRQFVRKYSLPEGAE 470 +K+ +I LDV+ + P+EIS K G V V+ +H + E G+ ++F R ++LPEG + Sbjct: 3 KKNTLEIAKLDVKEYRPEEISFKVENGVVKVQGRH-VNEGEFGFELKEFRRTFTLPEGID 61 Query: 471 TANVVSELSADGILTVTAPRKVI 539 NV S +S G L + A RK + Sbjct: 62 PENVTSRISNHGHLHIEA-RKAL 83 Score = 48.8 bits (111), Expect = 5e-06 Identities = 25/83 (30%), Positives = 44/83 (53%) Frame = +3 Query: 288 KTEKDKFQINLDVQHFSPDEISVKTAEGYVVVEAKHEEKQDEHGYISRQFVRKYSLPEGA 467 K ++DKF + +DV F P+ I V+ ++V A HE + + H Y + F R++ LP Sbjct: 92 KAKEDKFSMAIDVAGFPPESIKVQVLGNELLVNANHEVEHEGH-YHAMHFNRQFVLPREV 150 Query: 468 ETANVVSELSADGILTVTAPRKV 536 + ++ + L +G L A + V Sbjct: 151 DMDSLTTRLDKEGKLHFEAKKSV 173 >SB_38963| Best HMM Match : HSP20 (HMM E-Value=7.3e-26) Length = 190 Score = 55.2 bits (127), Expect = 6e-08 Identities = 28/77 (36%), Positives = 47/77 (61%), Gaps = 1/77 (1%) Frame = +3 Query: 297 KDKFQI-NLDVQHFSPDEISVKTAEGYVVVEAKHEEKQDEHGYISRQFVRKYSLPEGAET 473 ++K +I LDV+ + P+EIS K G+V V+ +H + G+ ++F R ++LPEG E Sbjct: 4 ENKLEIAKLDVREYRPEEISFKVENGFVKVQGRH-VNEGPFGFELKEFRRTFALPEGVEA 62 Query: 474 ANVVSELSADGILTVTA 524 +NV + +S G L + A Sbjct: 63 SNVKTRISNHGQLHIEA 79 Score = 46.8 bits (106), Expect = 2e-05 Identities = 24/78 (30%), Positives = 41/78 (52%) Frame = +3 Query: 300 DKFQINLDVQHFSPDEISVKTAEGYVVVEAKHEEKQDEHGYISRQFVRKYSLPEGAETAN 479 DKF + +DV F PD I V+ ++V A HE + + H Y + F R++ LP + + Sbjct: 97 DKFSMAMDVTGFPPDSIKVQVLGNELLVSANHEVEHEGH-YHAMHFNRQFVLPREVDMDS 155 Query: 480 VVSELSADGILTVTAPRK 533 + + L +G L A ++ Sbjct: 156 LTTRLDKEGKLHFEAKKR 173 >SB_37349| Best HMM Match : HSP20 (HMM E-Value=7.3e-26) Length = 190 Score = 55.2 bits (127), Expect = 6e-08 Identities = 28/77 (36%), Positives = 47/77 (61%), Gaps = 1/77 (1%) Frame = +3 Query: 297 KDKFQI-NLDVQHFSPDEISVKTAEGYVVVEAKHEEKQDEHGYISRQFVRKYSLPEGAET 473 ++K +I LDV+ + P+EIS K G+V V+ +H + G+ ++F R ++LPEG E Sbjct: 4 ENKLEIAKLDVREYRPEEISFKVENGFVKVQGRH-VNEGPFGFELKEFRRTFALPEGVEA 62 Query: 474 ANVVSELSADGILTVTA 524 +NV + +S G L + A Sbjct: 63 SNVKTRISNHGQLHIEA 79 Score = 46.8 bits (106), Expect = 2e-05 Identities = 24/78 (30%), Positives = 41/78 (52%) Frame = +3 Query: 300 DKFQINLDVQHFSPDEISVKTAEGYVVVEAKHEEKQDEHGYISRQFVRKYSLPEGAETAN 479 DKF + +DV F PD I V+ ++V A HE + + H Y + F R++ LP + + Sbjct: 97 DKFSMAMDVTGFPPDSIKVQVLGNELLVSANHEVEHEGH-YHAMHFNRQFVLPREVDMDS 155 Query: 480 VVSELSADGILTVTAPRK 533 + + L +G L A ++ Sbjct: 156 LTTRLDKEGKLHFEAKKR 173 >SB_58907| Best HMM Match : HSP20 (HMM E-Value=4.2e-05) Length = 259 Score = 40.7 bits (91), Expect = 0.001 Identities = 23/62 (37%), Positives = 34/62 (54%), Gaps = 1/62 (1%) Frame = +3 Query: 279 STIKTEKDKFQINLDVQHFSPDEISVKTAEGYVVVEAKHEEKQDEHGYI-SRQFVRKYSL 455 S + KF + LDV F P+E+ VK + V A+ E +EHG+ +RQF R + L Sbjct: 19 SAATKDDTKFTLALDVSDFKPEEVDVKVYGHELSVRARQE--CEEHGFFTARQFNRHFVL 76 Query: 456 PE 461 P+ Sbjct: 77 PQ 78 >SB_18447| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 32.3 bits (70), Expect = 0.45 Identities = 13/44 (29%), Positives = 23/44 (52%) Frame = +3 Query: 285 IKTEKDKFQINLDVQHFSPDEISVKTAEGYVVVEAKHEEKQDEH 416 I + D+F I D H DE+ ++T E Y+ + H ++ + H Sbjct: 45 IHLDTDEFHIETDELHIDIDELHIETYELYIDTDELHTDRNEIH 88 >SB_25956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1146 Score = 30.3 bits (65), Expect = 1.8 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 2/59 (3%) Frame = +3 Query: 315 NLDVQHFSPDEI--SVKTAEGYVVVEAKHEEKQDEHGYISRQFVRKYSLPEGAETANVV 485 ++DV S ++I ++ A+G + E+ H DE+G I F++ S E A A V Sbjct: 94 DVDVSSISGEDILRAIDAADGDISGESGHVTDSDENGDIDSSFIKLESSSESAPLATKV 152 >SB_39858| Best HMM Match : Spectrin (HMM E-Value=2.6e-05) Length = 3397 Score = 30.3 bits (65), Expect = 1.8 Identities = 15/44 (34%), Positives = 21/44 (47%) Frame = +3 Query: 384 EAKHEEKQDEHGYISRQFVRKYSLPEGAETANVVSELSADGILT 515 E K+EE DEHG I R+ + E V ++ DG+ T Sbjct: 1187 ETKYEEYVDEHGQIIRRTTKVKHTAVKQERTTVTKTVTRDGVTT 1230 >SB_3515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1295 Score = 29.9 bits (64), Expect = 2.4 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = -3 Query: 258 TPCAAKVGSSRELSTASSCLLRSRPELAASRSPD 157 TP +A SS L S+CL+ S+P L +S D Sbjct: 835 TPSSATSTSSLSLKATSTCLVESKPPLTKQKSLD 868 >SB_12240| Best HMM Match : IBB (HMM E-Value=9.5) Length = 161 Score = 29.5 bits (63), Expect = 3.1 Identities = 27/85 (31%), Positives = 38/85 (44%), Gaps = 1/85 (1%) Frame = +3 Query: 426 SRQFVRKYSLPEGAETANVVSELSADGILTVTAPRKVIDDKGERVVPIT-KTGPVRKESA 602 +R+ + K + P ET E A G T P+ V+D+ ERV P+T TG R E + Sbjct: 35 NRRHILKTNEPALQETDTPFQEPEASG--EDTPPQIVLDESNERVRPVTMPTGLRRSERS 92 Query: 603 ESKNSKEADPGFCEDGKSEMQ*RLV 677 + D G E+Q LV Sbjct: 93 KQVPVWHEDYEVTMRGALEVQRDLV 117 >SB_56248| Best HMM Match : RVT_1 (HMM E-Value=8.6e-20) Length = 1193 Score = 29.5 bits (63), Expect = 3.1 Identities = 22/65 (33%), Positives = 32/65 (49%), Gaps = 1/65 (1%) Frame = +3 Query: 426 SRQFVRKYSLPEGAETANVVSELSADGILTVTAPRKVIDDKGERVVPIT-KTGPVRKESA 602 +R+ + K + P ET E A G T P+ V+D+ ERV P+T TG R E + Sbjct: 1109 NRRHILKTNEPALRETDTPFQEPEASG--EDTPPQIVLDESNERVRPVTMPTGLRRSERS 1166 Query: 603 ESKNS 617 + S Sbjct: 1167 KQCRS 1171 >SB_59029| Best HMM Match : Pkinase (HMM E-Value=0) Length = 1023 Score = 29.1 bits (62), Expect = 4.2 Identities = 14/54 (25%), Positives = 28/54 (51%) Frame = +3 Query: 303 KFQINLDVQHFSPDEISVKTAEGYVVVEAKHEEKQDEHGYISRQFVRKYSLPEG 464 K +IN D + ++ + + + Y+ AK E + ++G ++ +KY PEG Sbjct: 730 KLRINADEKEEQEQKVPISSDKRYINGHAKDENETVKNGNMNLDNSQKYFSPEG 783 >SB_13913| Best HMM Match : WH2 (HMM E-Value=8.8e-05) Length = 493 Score = 29.1 bits (62), Expect = 4.2 Identities = 36/138 (26%), Positives = 60/138 (43%), Gaps = 4/138 (2%) Frame = +3 Query: 129 KKQRDNKLVDQDFGMPLTPDDFLTNMMTPWIVHDYFRPWRHTASLARDLGSTIKTEKDKF 308 KK+R++K FG L+P+ F + V P R ++ D S + +K K Sbjct: 140 KKRRESKSKRVSFGPMLSPEQFDKELPPATPVRRGATPRR----VSSDRKSLLMDQKKKH 195 Query: 309 QINLD-VQHFSPDEISVKTAEGYVVVEAKHEEKQDEHGYISRQFVRK---YSLPEGAETA 476 +N + ++ +E + KT E V E K EE ++E + + V + LPE T Sbjct: 196 IVNENRIEELPEEEATPKTPE--EVEENKIEEPEEEAISKTPEEVTENKIKELPEEEATP 253 Query: 477 NVVSELSADGILTVTAPR 530 V E ++AP+ Sbjct: 254 KEVKETPRRSSRRLSAPQ 271 >SB_24406| Best HMM Match : DUF536 (HMM E-Value=1.5) Length = 436 Score = 29.1 bits (62), Expect = 4.2 Identities = 9/24 (37%), Positives = 17/24 (70%) Frame = +3 Query: 384 EAKHEEKQDEHGYISRQFVRKYSL 455 + KHEE++D HGY+ + +++L Sbjct: 70 QVKHEEREDRHGYLKDKVTLQHAL 93 >SB_27758| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1926 Score = 28.7 bits (61), Expect = 5.5 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +3 Query: 537 IDDKGERVVPITKTGPVRKESAESKNSKEADPG 635 ID K + V +K+ V K ++ K+SKE DPG Sbjct: 763 IDAKSKDVRSKSKSKSVEKRTSTEKSSKEPDPG 795 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 28.3 bits (60), Expect = 7.3 Identities = 21/48 (43%), Positives = 24/48 (50%), Gaps = 3/48 (6%) Frame = -3 Query: 264 PKTPCA--AKVGSSRELSTA-SSCLLRSRPELAASRSPDPQVCCLAAF 130 PK C+ KVGS+ S SSCLL +P P CCLAAF Sbjct: 1886 PKKCCSKPTKVGSAPTSSQCPSSCLLACQPSC-------PMECCLAAF 1926 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,078,426 Number of Sequences: 59808 Number of extensions: 454238 Number of successful extensions: 1458 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 1294 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1454 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2095976575 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -