SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= maV30291
         (762 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At4g30830.1 68417.m04373 expressed protein weak similarity to M ...    28   7.8  

>At4g30830.1 68417.m04373 expressed protein weak similarity to M
           protein type 1 [Streptococcus pyogenes] GI:311758;
           contains Pfam profile PF04576: Protein of unknown
           function, DUF593
          Length = 363

 Score = 27.9 bits (59), Expect = 7.8
 Identities = 22/73 (30%), Positives = 31/73 (42%)
 Frame = +2

Query: 533 QITKEKKHLNKHLKVRKINKTLQMAKILKNPVKMKTPVKNLKRL*IKTVKHSHQMHLQRL 712
           ++T+E+K   K L   K      M K+ K     K P K  +    K  +  +Q  LQRL
Sbjct: 231 EVTQERKKEAKGLS--KTTDDTMMIKVSKQTKMEKKPSKQTRDRSGKRNRAEYQAELQRL 288

Query: 713 VMKNHRKRMVKSN 751
             +  R    KSN
Sbjct: 289 RQRVERLERGKSN 301


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.300    0.123    0.327 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 11,382,777
Number of Sequences: 28952
Number of extensions: 160361
Number of successful extensions: 228
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 225
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 228
length of database: 12,070,560
effective HSP length: 79
effective length of database: 9,783,352
effective search space used: 1702303248
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 17 ( 7.4 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 43 (21.6 bits)

- SilkBase 1999-2023 -