BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30287 (722 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292373-1|CAL23185.2| 360|Tribolium castaneum gustatory recept... 21 7.6 AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory recept... 21 7.6 >AM292373-1|CAL23185.2| 360|Tribolium castaneum gustatory receptor candidate 52 protein. Length = 360 Score = 21.4 bits (43), Expect = 7.6 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -3 Query: 495 FDVCILLEFVDEVPKENPVLIAGMLFIVLVA 403 FD+C+L E VD V N + +LF++ A Sbjct: 209 FDICLLKEGVDLV---NDIFGWQILFLITYA 236 >AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory receptor candidate 32 protein. Length = 651 Score = 21.4 bits (43), Expect = 7.6 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -3 Query: 495 FDVCILLEFVDEVPKENPVLIAGMLFIVLVA 403 FD+C+L E VD V N + +LF++ A Sbjct: 209 FDICLLKEGVDLV---NDIFGWQILFLITYA 236 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 153,673 Number of Sequences: 336 Number of extensions: 3173 Number of successful extensions: 10 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19259425 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -