BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30286 (773 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein p... 27 0.85 AJ302660-1|CAC35525.1| 195|Anopheles gambiae hypothetical prote... 25 2.0 DQ974173-1|ABJ52813.1| 553|Anopheles gambiae serpin 16 protein. 25 3.4 EF989011-1|ABS17666.1| 399|Anopheles gambiae serpin 7 protein. 24 4.5 AF004915-1|AAB94671.1| 688|Anopheles gambiae pro-phenol oxidase... 24 4.5 DQ139945-1|ABA29466.1| 399|Anopheles gambiae protein O-fucosylt... 24 6.0 DQ974168-1|ABJ52808.1| 447|Anopheles gambiae serpin 9 protein. 23 7.9 AY146717-1|AAO12077.1| 188|Anopheles gambiae odorant-binding pr... 23 7.9 >AB097148-2|BAC82628.1| 1077|Anopheles gambiae pol-like protein protein. Length = 1077 Score = 26.6 bits (56), Expect = 0.85 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 1/41 (2%) Frame = +2 Query: 440 GDLNVVYL-VNSGSEANELATLLAKAYTGNLDIISLQTSYH 559 G N+ + +N+ S A +L L T +LD+I LQ YH Sbjct: 14 GSCNIASININTISSATKLEALKTFIRTMDLDVIFLQEVYH 54 >AJ302660-1|CAC35525.1| 195|Anopheles gambiae hypothetical protein protein. Length = 195 Score = 25.4 bits (53), Expect = 2.0 Identities = 14/54 (25%), Positives = 22/54 (40%) Frame = +3 Query: 609 WPFPSLQVSTTQSTLILSEALSEAAGTLSRKLQDPARAPESASALTNMSTNLTS 770 W FP+L +TT A S A S +++ L + TN+T+ Sbjct: 32 WSFPALSPTTTTLATTSGTAASSGASNSSNVSVAIGNRVNTSTGLDDYGTNITN 85 >DQ974173-1|ABJ52813.1| 553|Anopheles gambiae serpin 16 protein. Length = 553 Score = 24.6 bits (51), Expect = 3.4 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +3 Query: 372 IRPTCTDIRKSMSTSNN 422 ++P+ TDIR+ S SNN Sbjct: 452 LQPSSTDIRRGTSNSNN 468 >EF989011-1|ABS17666.1| 399|Anopheles gambiae serpin 7 protein. Length = 399 Score = 24.2 bits (50), Expect = 4.5 Identities = 12/24 (50%), Positives = 18/24 (75%) Frame = +3 Query: 651 LILSEALSEAAGTLSRKLQDPARA 722 L +S AL ++ G LS++L+D ARA Sbjct: 120 LNVSFALLQSEGQLSQELEDAARA 143 >AF004915-1|AAB94671.1| 688|Anopheles gambiae pro-phenol oxidase subunit 1 protein. Length = 688 Score = 24.2 bits (50), Expect = 4.5 Identities = 17/52 (32%), Positives = 23/52 (44%) Frame = +2 Query: 263 DGKRYLDLFGGIVTVSVGHCHPKVNAALKDQLDVLWHTTNLYRHPKIYEYVE 418 D +R +D+ G +V S P NA L L + H Y H Y Y+E Sbjct: 336 DEQRGIDILGDVVEAS--SLTP--NAQLYGSLHNMGHNVIAYVHDPDYRYLE 383 >DQ139945-1|ABA29466.1| 399|Anopheles gambiae protein O-fucosyltransferase 1 protein. Length = 399 Score = 23.8 bits (49), Expect = 6.0 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = -3 Query: 117 VGGILAVLYVLTMSKHNFVPLLAISMCFSVEAIAICHT 4 VG + A V+TM NF+ LA S+ E I+ C+T Sbjct: 82 VGPLQAFHRVITME--NFMKTLAPSLWPPAERISFCYT 117 >DQ974168-1|ABJ52808.1| 447|Anopheles gambiae serpin 9 protein. Length = 447 Score = 23.4 bits (48), Expect = 7.9 Identities = 9/25 (36%), Positives = 12/25 (48%) Frame = +2 Query: 587 TATQSYRMAIPVPPGFYHAVHPDPF 661 T S+R + P P +H HP F Sbjct: 403 TVAFSFRSSRPADPAMFHCNHPFVF 427 >AY146717-1|AAO12077.1| 188|Anopheles gambiae odorant-binding protein AgamOBP14 protein. Length = 188 Score = 23.4 bits (48), Expect = 7.9 Identities = 9/30 (30%), Positives = 16/30 (53%) Frame = +1 Query: 295 NRHRLRGPLSSESKCSPQRSTRCIVAYDQP 384 +RH L+ L + C Q++ +C+ A P Sbjct: 107 DRHYLQYGLGQDYNCFRQKAEQCLAANTSP 136 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 879,062 Number of Sequences: 2352 Number of extensions: 19677 Number of successful extensions: 90 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 88 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 90 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 80665782 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -