BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30285 (476 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_43520| Best HMM Match : RNase_PH (HMM E-Value=0.00011) 31 0.49 SB_9212| Best HMM Match : RVT_1 (HMM E-Value=4.5e-36) 27 7.9 >SB_43520| Best HMM Match : RNase_PH (HMM E-Value=0.00011) Length = 972 Score = 31.1 bits (67), Expect = 0.49 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -3 Query: 300 CFVSIYYYCYFYIANLISYICY 235 C+ YYYCY+Y Y CY Sbjct: 480 CYCYCYYYCYYYCYCYCYYCCY 501 Score = 29.5 bits (63), Expect = 1.5 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = -3 Query: 300 CFVSIYYYCYFYIANLISYICY 235 C+ YYYCY Y Y CY Sbjct: 472 CYCYCYYYCYCYCYYYCYYYCY 493 >SB_9212| Best HMM Match : RVT_1 (HMM E-Value=4.5e-36) Length = 449 Score = 27.1 bits (57), Expect = 7.9 Identities = 11/32 (34%), Positives = 18/32 (56%) Frame = -3 Query: 414 SINVSYPRYMLIGTKKTMGTEHHFITIKTCSK 319 S+NV+ YM++G+ + + H I IK K Sbjct: 418 SLNVTKTEYMILGSAQRLSNLEHLINIKINEK 449 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,072,582 Number of Sequences: 59808 Number of extensions: 159419 Number of successful extensions: 272 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 250 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 270 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 989515521 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -