BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30284 (309 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z75711-4|CAB00030.1| 134|Caenorhabditis elegans Hypothetical pr... 26 6.2 Z68009-1|CAA92003.1| 1095|Caenorhabditis elegans Hypothetical pr... 26 6.2 >Z75711-4|CAB00030.1| 134|Caenorhabditis elegans Hypothetical protein K02B12.6 protein. Length = 134 Score = 25.8 bits (54), Expect = 6.2 Identities = 11/44 (25%), Positives = 26/44 (59%), Gaps = 7/44 (15%) Frame = -2 Query: 257 VLLISVCAVSAI-------YLPDDSNSADLDKYKSESFGSKLYS 147 +L++SVC + A+ Y P +++ ++++++GSK Y+ Sbjct: 7 ILVLSVCTIGALAVMEHNSYYPGGHSTSYYQPFQTDTYGSKYYN 50 >Z68009-1|CAA92003.1| 1095|Caenorhabditis elegans Hypothetical protein R09A8.1 protein. Length = 1095 Score = 25.8 bits (54), Expect = 6.2 Identities = 15/51 (29%), Positives = 24/51 (47%) Frame = -2 Query: 305 FFHVLLKTFKMKTIYFVLLISVCAVSAIYLPDDSNSADLDKYKSESFGSKL 153 FFH+L K + +L IS+ V + + + NSA K + G+ L Sbjct: 658 FFHILKSKRKFYILLHILYISINLVKSFLVFNSQNSAPPIKPMKKEAGALL 708 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,558,805 Number of Sequences: 27780 Number of extensions: 44900 Number of successful extensions: 115 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 115 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 115 length of database: 12,740,198 effective HSP length: 71 effective length of database: 10,767,818 effective search space used: 333802358 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -