BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30283 (706 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CY... 29 0.14 AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. 27 0.76 AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcript... 25 2.3 AY745222-1|AAU93489.1| 276|Anopheles gambiae cytochrome P450 pr... 24 5.4 AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 24 5.4 AY745233-1|AAU93512.1| 100|Anopheles gambiae SOD3B protein. 23 7.1 AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-spe... 23 7.1 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 23 7.1 AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CY... 23 9.4 >AF487533-1|AAL93294.1| 531|Anopheles gambiae cytochrome P450 CYP9K1 protein. Length = 531 Score = 29.1 bits (62), Expect = 0.14 Identities = 13/29 (44%), Positives = 20/29 (68%) Frame = -2 Query: 516 NSGASA*IAAVLSVGMGPRSSIGSPITLM 430 ++GA +A+L+ G+GPR+ IGS LM Sbjct: 455 SAGAPVDSSAMLAFGLGPRNCIGSRFALM 483 >AY239359-1|AAO73809.1| 2259|Anopheles gambiae dicer-1 protein. Length = 2259 Score = 26.6 bits (56), Expect = 0.76 Identities = 12/26 (46%), Positives = 12/26 (46%) Frame = +1 Query: 325 DHCHGRY*RLSPWATCTRLWLTHSYP 402 D CH Y R W C R LTH P Sbjct: 153 DECHKNYGRQELWEICAR--LTHQAP 176 >AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcriptase protein. Length = 973 Score = 25.0 bits (52), Expect = 2.3 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +1 Query: 22 ISENVGGNKSSWKR 63 I N+GG KSSW+R Sbjct: 739 IMPNIGGPKSSWRR 752 >AY745222-1|AAU93489.1| 276|Anopheles gambiae cytochrome P450 protein. Length = 276 Score = 23.8 bits (49), Expect = 5.4 Identities = 12/29 (41%), Positives = 15/29 (51%) Frame = -2 Query: 513 SGASA*IAAVLSVGMGPRSSIGSPITLMM 427 SGAS + G+GPR IG LM+ Sbjct: 212 SGASKNRPPFMPFGLGPRHCIGDTFGLML 240 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 23.8 bits (49), Expect = 5.4 Identities = 12/30 (40%), Positives = 15/30 (50%), Gaps = 1/30 (3%) Frame = -2 Query: 426 RPRVSAPTGIRMGEPESSTGCPRT-KPSVP 340 RP P G +M P + G PRT P+ P Sbjct: 180 RPNPGMPPGPQMMRPPGNVGPPRTGTPTQP 209 >AY745233-1|AAU93512.1| 100|Anopheles gambiae SOD3B protein. Length = 100 Score = 23.4 bits (48), Expect = 7.1 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = -1 Query: 349 FSTVHGNGPNCVLTQMLGYLKYEAGRSILHL 257 +S GN NC+ ++G + E LHL Sbjct: 70 YSKTTGNSGNCIACAIIGVAREEYFAERLHL 100 >AY725819-1|AAU50567.1| 569|Anopheles gambiae fruitless male-specific zinc-fingerC isoform protein. Length = 569 Score = 23.4 bits (48), Expect = 7.1 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = -1 Query: 700 QQTQSTHHGLWQHC*SVPISIQFGHTSSAKQPNLSS 593 QQ Q THH QH S Q +S +QP+ S+ Sbjct: 247 QQQQQTHHQQQQHPSSHQQQSQQHPSSQHQQPSRSA 282 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 23.4 bits (48), Expect = 7.1 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = -2 Query: 423 PRVSAPTGIRMGEPESSTGCPRTKPSVPSMAM 328 P +SAP G+ M G P P PS+ + Sbjct: 558 PGLSAPLGLGMRPQGGPLGLPSHHPLHPSLGL 589 >AF487781-1|AAL96668.1| 533|Anopheles gambiae cytochrome P450 CYP9L1 protein protein. Length = 533 Score = 23.0 bits (47), Expect = 9.4 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -2 Query: 495 IAAVLSVGMGPRSSIGSPITLM 430 + A L G+GPR+ I S LM Sbjct: 462 LGAYLPFGIGPRNCIASRFALM 483 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 770,714 Number of Sequences: 2352 Number of extensions: 15984 Number of successful extensions: 41 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 40 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 41 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71922660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -