BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30280 (627 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcript... 26 1.1 AJ439353-7|CAD27929.1| 555|Anopheles gambiae putative glycerol ... 25 1.5 AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcript... 24 3.4 >AB090813-2|BAC57902.1| 1099|Anopheles gambiae reverse transcriptase protein. Length = 1099 Score = 25.8 bits (54), Expect = 1.1 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = -2 Query: 389 VAL*PHTVPLNGRYSILDIIIIVHRWVNVHHFEV 288 V L P T P N + + + II V W+ HH E+ Sbjct: 663 VLLVPGTTPDNVKAAAEEAIISVMEWMARHHLEL 696 >AJ439353-7|CAD27929.1| 555|Anopheles gambiae putative glycerol kinase protein. Length = 555 Score = 25.4 bits (53), Expect = 1.5 Identities = 17/73 (23%), Positives = 26/73 (35%), Gaps = 3/73 (4%) Frame = +3 Query: 393 ETKSEAAYVTSRNVALRNELDMYAYILNCKSYPGVATRHKDIDVVIIRQNTEGEYA---M 563 E AA T+ A N +D+Y + Y GV + H+ + Y M Sbjct: 449 EVHEPAALGTAMAAAQANGVDLYKLEAEIRGYAGVQSHHETFLPTTTEEERNARYTKWKM 508 Query: 564 LEHESVEWVWSSQ 602 S+ W S + Sbjct: 509 AVQRSLGWAVSKK 521 >AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcriptase protein. Length = 1154 Score = 24.2 bits (50), Expect = 3.4 Identities = 11/34 (32%), Positives = 15/34 (44%) Frame = -2 Query: 389 VAL*PHTVPLNGRYSILDIIIIVHRWVNVHHFEV 288 V L P T P + + V RW+ HH E+ Sbjct: 677 VLLAPGTTPAAAAVVAEEAVSAVDRWLREHHLEL 710 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 711,884 Number of Sequences: 2352 Number of extensions: 16833 Number of successful extensions: 14 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 61050630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -