BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30280 (627 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 24 1.4 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 23 1.8 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 23 1.8 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 23 1.8 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 23 1.8 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 23 2.4 AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cycl... 23 3.2 AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cycl... 23 3.2 DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 21 7.4 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 23.8 bits (49), Expect = 1.4 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = +3 Query: 312 PTMDNDDDVQYAITTIKRNGVGLKGNIETKSEA 410 P D D++ + + + RNG G+ G + EA Sbjct: 354 PKKDEDEEEEEEVVVVGRNGAGV-GAMNANGEA 385 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 23.4 bits (48), Expect = 1.8 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +3 Query: 519 DVVIIRQNTEGEYAMLEHESVE 584 DV++IR+ EG + E E ++ Sbjct: 148 DVIVIRRTGEGSKPLFEREEIK 169 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 23.4 bits (48), Expect = 1.8 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +3 Query: 519 DVVIIRQNTEGEYAMLEHESVE 584 DV++IR+ EG + E E ++ Sbjct: 159 DVIVIRRTGEGSKPLFEREEIK 180 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 23.4 bits (48), Expect = 1.8 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +3 Query: 519 DVVIIRQNTEGEYAMLEHESVE 584 DV++IR+ EG + E E ++ Sbjct: 159 DVIVIRRTGEGSKPLFEREEIK 180 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 23.4 bits (48), Expect = 1.8 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +3 Query: 519 DVVIIRQNTEGEYAMLEHESVE 584 DV++IR+ EG + E E ++ Sbjct: 148 DVIVIRRTGEGSKPLFEREEIK 169 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 23.0 bits (47), Expect = 2.4 Identities = 8/21 (38%), Positives = 16/21 (76%), Gaps = 1/21 (4%) Frame = +3 Query: 429 NVALRNELDM-YAYILNCKSY 488 + +L N+ + ++Y+LNCK+Y Sbjct: 18 SASLENDNEFGFSYLLNCKNY 38 >AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 22.6 bits (46), Expect = 3.2 Identities = 10/44 (22%), Positives = 20/44 (45%) Frame = +3 Query: 372 VGLKGNIETKSEAAYVTSRNVALRNELDMYAYILNCKSYPGVAT 503 +G+ + K + R + +NE D +++ S PGV + Sbjct: 147 IGIVKTVAKKLHGTDIEMRILKTKNECDHVQFLITNTSGPGVVS 190 >AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 22.6 bits (46), Expect = 3.2 Identities = 10/44 (22%), Positives = 20/44 (45%) Frame = +3 Query: 372 VGLKGNIETKSEAAYVTSRNVALRNELDMYAYILNCKSYPGVAT 503 +G+ + K + R + +NE D +++ S PGV + Sbjct: 147 IGIVKTVAKKLHGTDIEMRILKTKNECDHVQFLITNTSGPGVVS 190 >DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine receptor beta2subunit protein. Length = 427 Score = 21.4 bits (43), Expect = 7.4 Identities = 10/31 (32%), Positives = 14/31 (45%) Frame = -3 Query: 586 HSTDSCSNIAYSPSVFCLIITTSMSLCLVAT 494 HS S PSV C++ + LC+ T Sbjct: 123 HSVTSVGIDLEMPSVECIVFNSGTILCVPFT 153 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 185,222 Number of Sequences: 438 Number of extensions: 3966 Number of successful extensions: 11 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18704709 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -