BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30277 (502 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855504-1|ABH88191.1| 124|Tribolium castaneum chemosensory pro... 24 0.67 AF452568-1|AAL57830.1| 243|Tribolium castaneum homeodomain tran... 23 1.2 AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. 23 1.2 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 21 6.2 EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglu... 21 8.2 >DQ855504-1|ABH88191.1| 124|Tribolium castaneum chemosensory protein 18 protein. Length = 124 Score = 24.2 bits (50), Expect = 0.67 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +1 Query: 379 DALYLPSVEDASRVLDEVAKGAVHV 453 +A Y PS E S+ DE+ K +HV Sbjct: 100 EAKYDPSGEYRSKYKDELEKNGIHV 124 >AF452568-1|AAL57830.1| 243|Tribolium castaneum homeodomain transcription factor Zen2 protein. Length = 243 Score = 23.4 bits (48), Expect = 1.2 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = -1 Query: 145 THWPRLELATGTVNGKTPSLYYTSGR 68 +H P +E G NGK YTS + Sbjct: 71 SHEPEMERPKGASNGKRARTAYTSSQ 96 >AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. Length = 292 Score = 23.4 bits (48), Expect = 1.2 Identities = 10/26 (38%), Positives = 13/26 (50%) Frame = -1 Query: 145 THWPRLELATGTVNGKTPSLYYTSGR 68 +H P +E G NGK YTS + Sbjct: 91 SHEPEMERPKGASNGKRARTAYTSSQ 116 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 21.0 bits (42), Expect = 6.2 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = +3 Query: 87 KDGVLPFTVPVASSKRG 137 KDGV+P V + S+++G Sbjct: 1080 KDGVIPDPVALKSAQQG 1096 >EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglucosaminidase FDL protein. Length = 630 Score = 20.6 bits (41), Expect = 8.2 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = +1 Query: 355 PYLYDNLSDALYLPSVEDASRVLDEVAKGAVHV 453 PY L A SVE RVLD +A ++V Sbjct: 239 PYRGIMLDTARNYMSVESIRRVLDGMAANKLNV 271 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 109,299 Number of Sequences: 336 Number of extensions: 2215 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11839801 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -