BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30277 (502 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBPB21E7.01c |eno102|eno1, SPBPB8B6.07c, eno1|enolase |Schizosa... 28 0.69 SPAC20G8.02 |||phospholipase|Schizosaccharomyces pombe|chr 1|||M... 25 6.4 SPAC1093.01 ||SPAC12B10.18|PPR repeat protein|Schizosaccharomyce... 25 6.4 SPBC16A3.10 |||membrane bound O-acyltransferase, MBOAT |Schizosa... 25 6.4 SPBC23E6.04c |utp10||U3 snoRNP-associated protein Utp10 |Schizos... 25 8.4 >SPBPB21E7.01c |eno102|eno1, SPBPB8B6.07c, eno1|enolase |Schizosaccharomyces pombe|chr 2|||Manual Length = 440 Score = 28.3 bits (60), Expect = 0.69 Identities = 22/77 (28%), Positives = 40/77 (51%), Gaps = 1/77 (1%) Frame = +1 Query: 271 DPYVIVFLEETLSVEDFSRKNNEGDISIPYLYDNLSDALYLPSVEDASRVLDEVAKGAVH 450 + Y IVF+E+ S ED+ + +S + ++D L + +V+ S+ ++ A+ Sbjct: 288 EKYPIVFIEDPFSEEDWGAFSY---MSSKTKVEVIADDLTVTNVKRLSKAIELKCANALL 344 Query: 451 VKLTQNG-LSAAIEDKN 498 VK+ Q G LS I+ N Sbjct: 345 VKINQIGSLSETIDAAN 361 >SPAC20G8.02 |||phospholipase|Schizosaccharomyces pombe|chr 1|||Manual Length = 757 Score = 25.0 bits (52), Expect = 6.4 Identities = 13/55 (23%), Positives = 25/55 (45%) Frame = +1 Query: 331 NNEGDISIPYLYDNLSDALYLPSVEDASRVLDEVAKGAVHVKLTQNGLSAAIEDK 495 N+ D S + N + LPS DAS ++ + H+ L +G+ + ++ Sbjct: 310 NDSSDPSDNFTPSNTESTIDLPSATDASHLMSRPDREVNHLILCCHGIGQKMGER 364 >SPAC1093.01 ||SPAC12B10.18|PPR repeat protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 1261 Score = 25.0 bits (52), Expect = 6.4 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +1 Query: 235 GFSEILNNELKDDPYVIVFLEETL 306 GF E+L EL+ D +V++ L TL Sbjct: 604 GFWEVLTEELQKDVHVLLSLVSTL 627 >SPBC16A3.10 |||membrane bound O-acyltransferase, MBOAT |Schizosaccharomyces pombe|chr 2|||Manual Length = 509 Score = 25.0 bits (52), Expect = 6.4 Identities = 10/23 (43%), Positives = 15/23 (65%) Frame = -1 Query: 367 HTGTESKYHLRYFYVKNLRPIRF 299 + G +S H R+ VKN+ PI+F Sbjct: 289 YNGLDSSKHPRWDRVKNIDPIKF 311 >SPBC23E6.04c |utp10||U3 snoRNP-associated protein Utp10 |Schizosaccharomyces pombe|chr 2|||Manual Length = 1649 Score = 24.6 bits (51), Expect = 8.4 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = +1 Query: 274 PYVIVFLEETLSVEDFSRKNNEGDI 348 PY+ + +LS+ D +RK+ EGD+ Sbjct: 1258 PYLADIVNYSLSILDDARKDPEGDL 1282 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,976,793 Number of Sequences: 5004 Number of extensions: 38716 Number of successful extensions: 110 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 109 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 110 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 198176188 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -