BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30275 (617 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. 27 0.48 DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domai... 25 2.0 AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase pr... 24 3.4 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 24 4.5 AY341186-1|AAR13750.1| 189|Anopheles gambiae GNBP A1 protein. 24 4.5 AY341185-1|AAR13749.1| 189|Anopheles gambiae GNBP A1 protein. 24 4.5 AY341183-1|AAR13747.1| 189|Anopheles gambiae GNBP A1 protein. 24 4.5 AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 24 4.5 AY341187-1|AAR13751.1| 189|Anopheles gambiae GNBP A1 protein. 23 6.0 AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/p... 23 7.9 >AY344830-1|AAR05801.1| 334|Anopheles gambiae ICHIT protein. Length = 334 Score = 27.1 bits (57), Expect = 0.48 Identities = 24/91 (26%), Positives = 34/91 (37%) Frame = -2 Query: 337 TPVTVSGTPWAVSTYSHIGFNVITSRDIRWTSVTRHQAHAHPPTMVRFVVGPKQPPETIS 158 T T + P +T+S + T+ W T PPT + P PP T + Sbjct: 193 TATTTTHAPTTTTTWSDLPPPPPTTTTTVWIDPTATTTTHVPPTTTTWSDLPPPPPTTTT 252 Query: 157 ASLGPTVWMLPILNPFTVTFTIHTLHFTTKT 65 TVW +P T T T +T + T Sbjct: 253 T----TVW----TDPTTTTTTDYTTAYPPTT 275 >DQ370045-1|ABD18606.1| 285|Anopheles gambiae putative TIL domain protein protein. Length = 285 Score = 25.0 bits (52), Expect = 2.0 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = +3 Query: 60 VIVLVVKCSVCIVKVTVKGFKMG 128 V+++ CS+C + TVK + G Sbjct: 135 VLIVAAGCSICAAQTTVKRYPTG 157 >AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase protein. Length = 1253 Score = 24.2 bits (50), Expect = 3.4 Identities = 14/43 (32%), Positives = 18/43 (41%) Frame = +2 Query: 395 PGQDRQRD*HDCPANVGGSFASYSRNSYSRRGVQRQGPIRGLG 523 PGQ +GG A+ R+S + G RQ GLG Sbjct: 1154 PGQQPSPGSRSYNGQMGGGGANRKRSSATNNGGGRQSSNNGLG 1196 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 23.8 bits (49), Expect = 4.5 Identities = 10/28 (35%), Positives = 16/28 (57%) Frame = -2 Query: 184 PKQPPETISASLGPTVWMLPILNPFTVT 101 P QPPET++ + + + P + P T T Sbjct: 1471 PVQPPETLTPAGSVAITVEPSVPPATTT 1498 >AY341186-1|AAR13750.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 23.8 bits (49), Expect = 4.5 Identities = 12/40 (30%), Positives = 16/40 (40%) Frame = -2 Query: 217 HPPTMVRFVVGPKQPPETISASLGPTVWMLPILNPFTVTF 98 H T + V PK T + ++ PT P P TF Sbjct: 112 HTVTRTKATVAPKSTTTTTTTTVKPTTTTPPPCPPTLTTF 151 >AY341185-1|AAR13749.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 23.8 bits (49), Expect = 4.5 Identities = 12/40 (30%), Positives = 16/40 (40%) Frame = -2 Query: 217 HPPTMVRFVVGPKQPPETISASLGPTVWMLPILNPFTVTF 98 H T + V PK T + ++ PT P P TF Sbjct: 112 HTVTRTKATVAPKSTTTTTTTTVKPTTTTPPPCPPTLTTF 151 >AY341183-1|AAR13747.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 23.8 bits (49), Expect = 4.5 Identities = 12/40 (30%), Positives = 16/40 (40%) Frame = -2 Query: 217 HPPTMVRFVVGPKQPPETISASLGPTVWMLPILNPFTVTF 98 H T + V PK T + ++ PT P P TF Sbjct: 112 HTVTRTKATVAPKSTTTTTTTTVKPTTTTPPPCPPTLTTF 151 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 23.8 bits (49), Expect = 4.5 Identities = 11/32 (34%), Positives = 16/32 (50%) Frame = -2 Query: 550 PTSGAATSRTKPANWSLSLYTSSTVRVPRIAR 455 P + + T+P +W S TS R+PR R Sbjct: 274 PPARRRSRSTRPTSWPRSRPTSKPKRLPRRRR 305 >AY341187-1|AAR13751.1| 189|Anopheles gambiae GNBP A1 protein. Length = 189 Score = 23.4 bits (48), Expect = 6.0 Identities = 12/40 (30%), Positives = 16/40 (40%) Frame = -2 Query: 217 HPPTMVRFVVGPKQPPETISASLGPTVWMLPILNPFTVTF 98 H T + V PK T + ++ PT P P TF Sbjct: 112 HTITRTKATVAPKSTTTTTTTTVKPTTTTPPPCPPTLTTF 151 >AY170874-1|AAO34131.1| 1221|Anopheles gambiae alkali metal ion/proton exchanger 3 protein. Length = 1221 Score = 23.0 bits (47), Expect = 7.9 Identities = 9/30 (30%), Positives = 16/30 (53%) Frame = -2 Query: 106 VTFTIHTLHFTTKTITNLFNLPKNQKKKKT 17 V FT+ T K + + N+ ++ K+K T Sbjct: 634 VYFTVFLQGITIKPLVKILNVKRSSKRKPT 663 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 709,887 Number of Sequences: 2352 Number of extensions: 16841 Number of successful extensions: 29 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 60553008 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -