BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30272 (692 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 25 0.52 DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 21 8.4 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 25.4 bits (53), Expect = 0.52 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +1 Query: 136 GTMNGHSTSHSVDTRKRLTPIP 201 G++NG+ +S D RK+ P P Sbjct: 159 GSLNGYGSSDGCDARKKKGPTP 180 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 21.4 bits (43), Expect = 8.4 Identities = 15/58 (25%), Positives = 25/58 (43%) Frame = +1 Query: 103 LFVYSVPPQVTGTMNGHSTSHSVDTRKRLTPIPDINTTGNHTPYKVRKQTLFILNYNT 276 L V+S P T+N S D + + I +N+T + P+ R + N+ T Sbjct: 381 LTVHSFP----STLNIPSVKIDEDQKCSIESITSVNSTSSPKPFPRRATLAQLHNFTT 434 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 156,016 Number of Sequences: 438 Number of extensions: 2973 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21195810 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -