BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30268 (750 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC7D4.10 |vma13||V-type ATPase subunit H|Schizosaccharomyces p... 33 0.057 SPCC1450.16c |||triacylglycerol lipase|Schizosaccharomyces pombe... 28 1.2 SPBC36B7.03 |sec63||ER protein translocation subcomplex subunit ... 28 1.6 SPCC16C4.02c |||DUF1941 family protein|Schizosaccharomyces pombe... 27 3.8 SPAC22F8.05 |||alpha,alpha-trehalose-phosphate synthase |Schizos... 26 5.0 SPBC577.08c |txl1|trx3|thioredoxin-like I protein Txl1|Schizosac... 26 5.0 SPAC23C11.16 |plo1||Polo kinase Plo1|Schizosaccharomyces pombe|c... 26 5.0 SPAC869.05c |||sulfate transporter |Schizosaccharomyces pombe|ch... 26 6.6 SPBC12D12.07c |trx2||mitochondrial thioredoxin Trx2|Schizosaccha... 26 6.6 SPAC13C5.02 |dre4||DNA replication protein Dre4|Schizosaccharomy... 25 8.7 >SPAC7D4.10 |vma13||V-type ATPase subunit H|Schizosaccharomyces pombe|chr 1|||Manual Length = 450 Score = 32.7 bits (71), Expect = 0.057 Identities = 34/173 (19%), Positives = 73/173 (42%), Gaps = 3/173 (1%) Frame = +2 Query: 209 SEIRQTQINWQSYLQSQMITQRDHDFIVNLDQR---GQKDLPDKNPDACAEVFLNLLTHI 379 + +R I WQ Y +S + + + I NL + +++ A + +FL LL+ Sbjct: 29 NNVRCVAIPWQGYQRSGSLEENELQEIENLTGKPLSAYVKTAEEDTTAYSNLFLKLLSMK 88 Query: 380 SKDHTIQYILVLIDDILSEDKSRVKIFRETKFSGNVWQPFLNLLNRQDEFVQHMTARIIA 559 + + LV + D L + F + + + + +N D+ + + AR+ A Sbjct: 89 DTPDVVNFALVKLADTLLNSNKFLSAFGPAFY--DFLEKDESYINYLDDDSKLLFARVFA 146 Query: 560 KLACWHPQLMDKSDLHFYLSWLKDQLKTNNNDYIQSVARCLQMMLRIDEYRFA 718 + P + K+ +L +L +++ N +CL +L + +R+A Sbjct: 147 LCSSSSPCSVAKA-FTLFLEYLGKLMQSLNPLTRLFAVQCLNGVLTLKAHRYA 198 >SPCC1450.16c |||triacylglycerol lipase|Schizosaccharomyces pombe|chr 3|||Manual Length = 513 Score = 28.3 bits (60), Expect = 1.2 Identities = 9/34 (26%), Positives = 22/34 (64%) Frame = -3 Query: 706 FIDTQHHLQTPGHRLDIVVVIGLELIFKPGEIEV 605 F D HH + G+ L ++ ++GLE+ ++ ++++ Sbjct: 397 FYDELHHHRVSGYSLKMIRLVGLEMAYRFRQLDI 430 >SPBC36B7.03 |sec63||ER protein translocation subcomplex subunit Sec63 |Schizosaccharomyces pombe|chr 2|||Manual Length = 611 Score = 27.9 bits (59), Expect = 1.6 Identities = 14/36 (38%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = -2 Query: 224 FGVSHLPGSVGRWWPQSCRFFR-HLALELTD*HFPR 120 FG+ LP +VG+WW S + R H+ ++ D FP+ Sbjct: 203 FGIV-LPYAVGKWWYGSRTYTRDHVHVDTVDEWFPK 237 >SPCC16C4.02c |||DUF1941 family protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 548 Score = 26.6 bits (56), Expect = 3.8 Identities = 16/66 (24%), Positives = 35/66 (53%) Frame = +2 Query: 464 ETKFSGNVWQPFLNLLNRQDEFVQHMTARIIAKLACWHPQLMDKSDLHFYLSWLKDQLKT 643 E++ S + + +LL+ QD+ + ++ ++AKL HP L+ K + +L L + Sbjct: 58 ESRGSMELLENCFSLLHAQDDTSKFVSLTMLAKLLNDHPNLIFKCWERMDMKFLDRLLLS 117 Query: 644 NNNDYI 661 + +Y+ Sbjct: 118 THYEYV 123 >SPAC22F8.05 |||alpha,alpha-trehalose-phosphate synthase |Schizosaccharomyces pombe|chr 1|||Manual Length = 891 Score = 26.2 bits (55), Expect = 5.0 Identities = 8/25 (32%), Positives = 16/25 (64%) Frame = -1 Query: 732 STERKAKRYSSIRSIICRHRATDWI 658 ST + +RYS+ ++ H A++W+ Sbjct: 580 STNERNQRYSNCLDVVLTHSASNWV 604 >SPBC577.08c |txl1|trx3|thioredoxin-like I protein Txl1|Schizosaccharomyces pombe|chr 2|||Manual Length = 290 Score = 26.2 bits (55), Expect = 5.0 Identities = 13/45 (28%), Positives = 25/45 (55%) Frame = -3 Query: 463 TKYLHPRFIFRKNVINEHKNVLNGVVLADMRQEVEKDFGTGIRIL 329 +KY P+F+F K ++E + + +G+ + M V + G I +L Sbjct: 46 SKYASPKFVFAKVNVDEQRQIASGLGVKAMPTFVFFENGKQIDML 90 >SPAC23C11.16 |plo1||Polo kinase Plo1|Schizosaccharomyces pombe|chr 1|||Manual Length = 683 Score = 26.2 bits (55), Expect = 5.0 Identities = 17/55 (30%), Positives = 28/55 (50%) Frame = +2 Query: 428 LSEDKSRVKIFRETKFSGNVWQPFLNLLNRQDEFVQHMTARIIAKLACWHPQLMD 592 L DK+++K+F E K ++ P N++ D F +I +L C H LM+ Sbjct: 76 LQNDKTKLKLFGEIKVHQSMSHP--NIVGFIDCFEDSTNIYLILEL-CEHKSLME 127 >SPAC869.05c |||sulfate transporter |Schizosaccharomyces pombe|chr 1|||Manual Length = 840 Score = 25.8 bits (54), Expect = 6.6 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -1 Query: 237 QLI*VWRISLARICRTLVAAIMSIFSSPSVGI 142 Q I WR+ C ++ I+S+FSS GI Sbjct: 492 QTILFWRLQPLEACIFFISVIVSVFSSIENGI 523 >SPBC12D12.07c |trx2||mitochondrial thioredoxin Trx2|Schizosaccharomyces pombe|chr 2|||Manual Length = 121 Score = 25.8 bits (54), Expect = 6.6 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = -2 Query: 398 EWCGPC*YASGG*ERLRHRHQ 336 +WCGPC Y E+L ++Q Sbjct: 45 DWCGPCKYLKPFLEKLSEQNQ 65 >SPAC13C5.02 |dre4||DNA replication protein Dre4|Schizosaccharomyces pombe|chr 1|||Manual Length = 411 Score = 25.4 bits (53), Expect = 8.7 Identities = 16/37 (43%), Positives = 18/37 (48%), Gaps = 1/37 (2%) Frame = +1 Query: 139 VNSNAR*RKNRHDCGHQRPTDPG-K*DTPNSD*LAVI 246 VN NA RKN D Q P P K PN+D V+ Sbjct: 62 VNENAEERKNSRDLRKQLPDRPKFKKRIPNNDSWVVV 98 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,028,243 Number of Sequences: 5004 Number of extensions: 58090 Number of successful extensions: 172 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 160 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 172 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 357280532 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -