BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30268 (750 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value X16709-1|CAA34681.1| 162|Apis mellifera phospholipase A-2 protein. 23 2.3 EF373554-1|ABQ28728.1| 167|Apis mellifera phospholipase A2 prot... 23 2.3 AF438408-1|AAL30844.1| 167|Apis mellifera phospholipase A2 prot... 23 2.3 AB073995-1|BAC76399.1| 301|Apis mellifera preprotachykinin prot... 23 3.1 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 23 4.0 AB073998-1|BAC76402.1| 339|Apis mellifera preprotachykinin prot... 21 9.3 >X16709-1|CAA34681.1| 162|Apis mellifera phospholipase A-2 protein. Length = 162 Score = 23.4 bits (48), Expect = 2.3 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -2 Query: 395 WCGPC*YASGG*ERLRHRHQDSC 327 WCG +SG E R +H D+C Sbjct: 36 WCGHGNKSSGPNELGRFKHTDAC 58 >EF373554-1|ABQ28728.1| 167|Apis mellifera phospholipase A2 protein. Length = 167 Score = 23.4 bits (48), Expect = 2.3 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -2 Query: 395 WCGPC*YASGG*ERLRHRHQDSC 327 WCG +SG E R +H D+C Sbjct: 41 WCGHGNKSSGPNELGRFKHTDAC 63 >AF438408-1|AAL30844.1| 167|Apis mellifera phospholipase A2 protein. Length = 167 Score = 23.4 bits (48), Expect = 2.3 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -2 Query: 395 WCGPC*YASGG*ERLRHRHQDSC 327 WCG +SG E R +H D+C Sbjct: 41 WCGHGNKSSGPNELGRFKHTDAC 63 >AB073995-1|BAC76399.1| 301|Apis mellifera preprotachykinin protein. Length = 301 Score = 23.0 bits (47), Expect = 3.1 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = -2 Query: 734 HRQRGKQSGIHRYAASSADTGPQTGYSRCY 645 H RGK+ Y ++S+ G GY Y Sbjct: 260 HGMRGKRDAAGIYGSNSSTVGTIFGYQGTY 289 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 22.6 bits (46), Expect = 4.0 Identities = 15/64 (23%), Positives = 29/64 (45%), Gaps = 2/64 (3%) Frame = +2 Query: 482 NVWQPFLNLLNRQD--EFVQHMTARIIAKLACWHPQLMDKSDLHFYLSWLKDQLKTNNND 655 N W+P NL+N D E + +++ + D+ +L++LK KT + Sbjct: 273 NTWEPISNLINCSDILEEFERNRLQLLESFKRKVNFYPNNQDIEKFLNYLKRGGKTLTSI 332 Query: 656 YIQS 667 ++S Sbjct: 333 SVES 336 >AB073998-1|BAC76402.1| 339|Apis mellifera preprotachykinin protein. Length = 339 Score = 21.4 bits (43), Expect = 9.3 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -2 Query: 734 HRQRGKQSGIHRYAASSADTGPQTGY 657 H RGK+ Y ++S+ G GY Sbjct: 260 HGMRGKRDAAGIYGSNSSTVGTIFGY 285 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 201,314 Number of Sequences: 438 Number of extensions: 4082 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23510295 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -