BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30267 (735 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_03_0570 - 17242362-17242694,17242714-17242758 29 2.9 01_05_0408 + 21888898-21890181,21891289-21891984,21892167-21893705 28 6.7 >04_03_0570 - 17242362-17242694,17242714-17242758 Length = 125 Score = 29.5 bits (63), Expect = 2.9 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 3/45 (6%) Frame = -1 Query: 315 CGARIG--DVPVFGTNGSICGRHIAYVVGR-IGTHCSVRIEHGRR 190 CG RI + P +GS+CGR + + V R +G+ R G R Sbjct: 41 CGQRIWRREGPRLVNSGSVCGRRVVWAVARLVGSRSGCRRRMGSR 85 >01_05_0408 + 21888898-21890181,21891289-21891984,21892167-21893705 Length = 1172 Score = 28.3 bits (60), Expect = 6.7 Identities = 17/62 (27%), Positives = 28/62 (45%) Frame = -1 Query: 501 ESSGPGTSESFSCIITRRITGACVIRLAKGRVWIVKSIIRTSVCGFCECTIYSYAFDVTG 322 E +G + +S + TR ++ C+ + R W K R +VCG C YA +G Sbjct: 866 EQAGIHSGDSACSLPTRTVSAKCLDII---RSWTTKLAKRLNVCGLMNC---QYAITTSG 919 Query: 321 TI 316 + Sbjct: 920 EV 921 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,902,970 Number of Sequences: 37544 Number of extensions: 391823 Number of successful extensions: 970 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 948 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 969 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1933531792 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -