BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30267 (735 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value D87343-1|BAA23225.1| 297|Homo sapiens DCRA protein. 30 9.9 BC110655-1|AAI10656.1| 297|Homo sapiens Down syndrome critical ... 30 9.9 >D87343-1|BAA23225.1| 297|Homo sapiens DCRA protein. Length = 297 Score = 29.9 bits (64), Expect = 9.9 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Frame = -1 Query: 486 GTSESFSCIITRRITGACVIRLAKGRVWIVK-SIIRTSVCGFCECTIYSYAFDVT 325 G S +C+IT+ +TG V+ ++ + V+ ++R CG E YA D T Sbjct: 180 GHLNSTNCVITQPLTGELVVESSEAAIRSVELQLVRVETCGCAE----GYARDAT 230 >BC110655-1|AAI10656.1| 297|Homo sapiens Down syndrome critical region gene 3 protein. Length = 297 Score = 29.9 bits (64), Expect = 9.9 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 1/55 (1%) Frame = -1 Query: 486 GTSESFSCIITRRITGACVIRLAKGRVWIVK-SIIRTSVCGFCECTIYSYAFDVT 325 G S +C+IT+ +TG V+ ++ + V+ ++R CG E YA D T Sbjct: 180 GHLNSTNCVITQPLTGELVVESSEAAIRSVELQLVRVETCGCAE----GYARDAT 230 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 103,005,432 Number of Sequences: 237096 Number of extensions: 2212163 Number of successful extensions: 4800 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4385 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4800 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8735159784 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -