BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30263 (670 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_44234| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.49 SB_29977| Best HMM Match : IL8 (HMM E-Value=1) 29 2.6 >SB_44234| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 218 Score = 31.9 bits (69), Expect = 0.49 Identities = 16/44 (36%), Positives = 22/44 (50%) Frame = +2 Query: 146 SYPLIRLTTVFDKGNNFDLCSAFTFADLAGGLPIFHINPNDQRT 277 S+ + +F NF + F DL+ LPIFHI ND+ T Sbjct: 162 SHTATLIDNMFCNRPNFSQIADILFNDLSDHLPIFHICTNDENT 205 >SB_29977| Best HMM Match : IL8 (HMM E-Value=1) Length = 521 Score = 29.5 bits (63), Expect = 2.6 Identities = 10/27 (37%), Positives = 18/27 (66%) Frame = -2 Query: 267 SLGLMWKMGRPPARSANVKAEHKSKLL 187 S+G +W+ G PA ++V +H S++L Sbjct: 152 SMGFLWRSGLKPAAQSSVSVQHISQIL 178 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,697,000 Number of Sequences: 59808 Number of extensions: 409695 Number of successful extensions: 1256 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1218 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1256 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1729817375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -