BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30263 (670 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 24 1.1 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 24 1.5 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 24 1.5 DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholi... 22 6.1 AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein... 22 6.1 AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein... 22 6.1 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 24.2 bits (50), Expect = 1.1 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +1 Query: 349 LAGEVLHQQNTLRLRLPPLSDFSPT*YSISQI 444 L+ +LH+ +T L +PPL++ P Y S I Sbjct: 129 LSVAILHRPDTKDLPVPPLTEVFPDKYMDSGI 160 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 23.8 bits (49), Expect = 1.5 Identities = 9/33 (27%), Positives = 20/33 (60%) Frame = +1 Query: 349 LAGEVLHQQNTLRLRLPPLSDFSPT*YSISQIL 447 L+ V+H+ +T ++LPP+ + P Y +++ Sbjct: 142 LSVAVIHRPDTKLMKLPPMYEVMPHLYFNDEVM 174 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 23.8 bits (49), Expect = 1.5 Identities = 9/33 (27%), Positives = 20/33 (60%) Frame = +1 Query: 349 LAGEVLHQQNTLRLRLPPLSDFSPT*YSISQIL 447 L+ V+H+ +T ++LPP+ + P Y +++ Sbjct: 142 LSVAVIHRPDTKLMKLPPMYEVMPHLYFNDEVM 174 >DQ026031-1|AAY87890.1| 601|Apis mellifera nicotinic acetylcholine receptor alpha1subunit protein. Length = 601 Score = 21.8 bits (44), Expect = 6.1 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = -1 Query: 406 SVVATEVAECSADEGPRQPVPLSEDVL 326 + V T VA C + P P+P ++D L Sbjct: 461 ATVGTTVAPCFEEPLPSLPLPGADDDL 487 >AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 21.8 bits (44), Expect = 6.1 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = -1 Query: 364 GPRQPVPLSEDVLSLVN 314 GP+ P+ + D SL+N Sbjct: 43 GPQSPLDMKPDTASLIN 59 >AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 21.8 bits (44), Expect = 6.1 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = -1 Query: 364 GPRQPVPLSEDVLSLVN 314 GP+ P+ + D SL+N Sbjct: 43 GPQSPLDMKPDTASLIN 59 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 178,577 Number of Sequences: 438 Number of extensions: 3807 Number of successful extensions: 10 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20221290 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -