Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= maV30260
         (602 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g16190.1 68416.m02044 isochorismatase hydrolase family protei...    31   0.44 

>At3g16190.1 68416.m02044 isochorismatase hydrolase family protein
           low similarity to SP|P32400 N-carbamoylsarcosine amidase
           (EC 3.5.1.59) (N-carbamoylsarcosine amidohydrolase)
           {Arthrobacter sp}; contains Pfam profile PF00857:
           isochorismatase family protein
          Length = 196

 Score = 31.5 bits (68), Expect = 0.44
 Identities = 16/32 (50%), Positives = 22/32 (68%)
 Frame = +3

Query: 195 DDFK*VKTRKSQFYSTTLAPFLRNTINTQIRI 290
           DD+K VKTR S F+ST L  FL+ +  T++ I
Sbjct: 101 DDYKIVKTRFSAFFSTNLHSFLQTSGVTKLVI 132


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 12,718,311
Number of Sequences: 28952
Number of extensions: 262103
Number of successful extensions: 477
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 465
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 477
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1197101088
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)