BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30245 (594 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1556.06.1 |meu1|SPAC1556.06a, SPAC1556.06|sequence orphan|Sc... 25 6.3 SPCC23B6.03c |tel1||ATM checkpoint kinase|Schizosaccharomyces po... 25 8.3 SPBC12C2.10c |pst1|SPBC21D10.01c|Clr6 histone deacetylase comple... 25 8.3 >SPAC1556.06.1 |meu1|SPAC1556.06a, SPAC1556.06|sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 776 Score = 25.4 bits (53), Expect = 6.3 Identities = 11/44 (25%), Positives = 24/44 (54%) Frame = +1 Query: 340 IREMNNMILLLTQIKTHKSIVTKYNLFFAFKYKHVCHFLKSIRH 471 I+++ +I ++Q++ + K NLF + H+ L+ +RH Sbjct: 353 IKQITTLIGKMSQVQIECKRLRKENLFLQSERTHLLRELEELRH 396 >SPCC23B6.03c |tel1||ATM checkpoint kinase|Schizosaccharomyces pombe|chr 3|||Manual Length = 2812 Score = 25.0 bits (52), Expect = 8.3 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -1 Query: 375 C*KKYHVVHFPDSLIFFYN 319 C K Y + FPDSL F++ Sbjct: 1522 CYKAYDITEFPDSLKLFFS 1540 >SPBC12C2.10c |pst1|SPBC21D10.01c|Clr6 histone deacetylase complex subunit Pst1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1522 Score = 25.0 bits (52), Expect = 8.3 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +3 Query: 147 TIFGPDKRICCL 182 T FGPD+ +CC+ Sbjct: 1159 TAFGPDENLCCI 1170 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,028,438 Number of Sequences: 5004 Number of extensions: 38472 Number of successful extensions: 92 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 89 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 92 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 258201856 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -