BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30245 (594 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_43395| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.6 >SB_43395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1112 Score = 32.7 bits (71), Expect = 0.23 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = -1 Query: 351 HFPDSLIFFYNKYIRTTIIGKTNYN 277 HF + I +YN+YIR T+ G T YN Sbjct: 70 HFYEEQIDYYNQYIRDTLAGITTYN 94 >SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 29.9 bits (64), Expect = 1.6 Identities = 17/52 (32%), Positives = 28/52 (53%) Frame = -1 Query: 432 FKCKEEVVFRDDGFVCFYLC*KKYHVVHFPDSLIFFYNKYIRTTIIGKTNYN 277 F C EVV DG +C + ++ F D + ++KY++TTI G T ++ Sbjct: 170 FSCTGEVVNYSDGRSAEDVCEQSSKLITFID--LAGHHKYMKTTIFGLTGHS 219 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,489,537 Number of Sequences: 59808 Number of extensions: 232962 Number of successful extensions: 490 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 417 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 488 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1427401750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -