SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= maV30245
         (594 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AB024574-1|BAB12431.1|  514|Homo sapiens GTP-binding like protei...    31   2.3  

>AB024574-1|BAB12431.1|  514|Homo sapiens GTP-binding like protein 2
           protein.
          Length = 514

 Score = 31.5 bits (68), Expect = 2.3
 Identities = 18/51 (35%), Positives = 26/51 (50%)
 Frame = -1

Query: 432 FKCKEEVVFRDDGFVCFYLC*KKYHVVHFPDSLIFFYNKYIRTTIIGKTNY 280
           F  KEEVV   D      +C     ++ F D  +  ++KY+ TTI G T+Y
Sbjct: 142 FNSKEEVVNYSDSRTAEEICESSSKMITFID--LAGHHKYLHTTIFGLTSY 190


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 62,621,087
Number of Sequences: 237096
Number of extensions: 1108619
Number of successful extensions: 1543
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1524
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1543
length of database: 76,859,062
effective HSP length: 86
effective length of database: 56,468,806
effective search space used: 6268037466
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -