BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30245 (594 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 23 2.3 DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex det... 21 6.9 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 23.0 bits (47), Expect = 2.3 Identities = 11/39 (28%), Positives = 24/39 (61%) Frame = +1 Query: 352 NNMILLLTQIKTHKSIVTKYNLFFAFKYKHVCHFLKSIR 468 N +++ T++K+ VTK ++FAF+ + C + +I+ Sbjct: 149 NTEVVINTEVKSIP--VTKKGVYFAFRDQGACISILAIK 185 >DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 21.4 bits (43), Expect = 6.9 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = +1 Query: 241 NLKVKHIHNKQEIIISFTNNC 303 +L K IHN ++ NNC Sbjct: 84 SLSNKTIHNNNNYKYNYNNNC 104 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 139,365 Number of Sequences: 438 Number of extensions: 3086 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17359926 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -