BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= maV30237 (639 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylch... 26 0.88 AY214334-1|AAP69612.1| 519|Anopheles gambiae nicotinate phospho... 24 4.7 CR954256-10|CAJ14151.1| 548|Anopheles gambiae putative alkaline... 23 6.2 AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcript... 23 6.2 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 23 8.2 >AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylcholine receptor subunitbeta 1 protein. Length = 519 Score = 26.2 bits (55), Expect = 0.88 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = -1 Query: 630 LVLYNGCPTLYTRIYKSRMVVPAGADLHYAPPPVY 526 +VL+N Y YKS +++ ++ + PP +Y Sbjct: 113 IVLFNNADGNYEVRYKSNVLIYPNGEVLWVPPAIY 147 >AY214334-1|AAP69612.1| 519|Anopheles gambiae nicotinate phosphoribosyltransferase-like protein protein. Length = 519 Score = 23.8 bits (49), Expect = 4.7 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = +3 Query: 168 TIVNYSHLITSKLEKFERVRLNHIELI 248 T+VNY+ L+ + ++ V HI L+ Sbjct: 116 TLVNYASLMATNAARYRMVAGKHIHLL 142 >CR954256-10|CAJ14151.1| 548|Anopheles gambiae putative alkaline phosphatase protein. Length = 548 Score = 23.4 bits (48), Expect = 6.2 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = +1 Query: 10 GSSRASFVSQWAGYNGCLGPG 72 G+ F+ Y GC+GPG Sbjct: 519 GTYEQHFIPHAMAYAGCIGPG 539 >AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcriptase protein. Length = 1168 Score = 23.4 bits (48), Expect = 6.2 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = -3 Query: 142 NTNSQYIRWAH 110 N S+Y+RWAH Sbjct: 896 NNTSRYLRWAH 906 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 23.0 bits (47), Expect = 8.2 Identities = 5/12 (41%), Positives = 10/12 (83%) Frame = +1 Query: 31 VSQWAGYNGCLG 66 +S+W ++GC+G Sbjct: 642 ISEWCSFHGCMG 653 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 696,893 Number of Sequences: 2352 Number of extensions: 13069 Number of successful extensions: 24 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 62723250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -